Serpin A1c Protein, Mouse (HEK293, His)
The Serpin A1c protein is a skilled guardian of cellular regulation, specifically acting as an inhibitor of serine proteases, specifically trypsin and chymotrypsin. Its efficacy in blocking enzymatic activity contrasts with its relative ineffectiveness against elastase. Serpin A1c Protein, Mouse (HEK293, His) is the recombinant mouse-derived Serpin A1c protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The Serpin A1c protein is a skilled guardian of cellular regulation, specifically acting as an inhibitor of serine proteases, specifically trypsin and chymotrypsin. Its efficacy in blocking enzymatic activity contrasts with its relative ineffectiveness against elastase. Serpin A1c Protein, Mouse (HEK293, His) is the recombinant mouse-derived Serpin A1c protein, expressed by HEK293 , with C-6*His labeled tag.
Background
Serpin A1c, a proficient guardian within the intricate realm of cellular regulation, assumes the role of an inhibitor specializing in serine proteases. Its watchful gaze extends to trypsin and chymotrypsin, where it showcases remarkable efficacy in thwarting their enzymatic activities. However, its prowess takes a nuanced turn, displaying a relative inefficacy against elastase. Serpin A1c's strategic inhibition of specific serine proteases underscores its significance as a discerning regulator, contributing to the delicate balance of enzymatic activities within cellular environments.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
AAC28869.1(E25-K413)
-
Gene ID20702 [NCBI]
-
Molecular Construction
-
N-term
-
A1cAAC28869.1(E25-K413)
Accession # AAC28869.1(E25-K413)Serpin -
6*His
-
C-term
-
-
Protein Length
Full Length of Alpha-1-antitrypsin 1-1 Chain
-
Synonyms
Alpha-1-antitrypsin 1-1; AAT; Alpha-1 protease inhibitor 1; Alpha-1-antiproteinase; Serine protease inhibitor 1-1 Serine protease inhibitor A1a; Serpin A1a; Serpina1a; Dom1; Spi1-1
-
AA Sequence
EDVQETDTSQKDQSPASHEIATNLGDFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHKSFQHLLQTLNRPDSELQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNFAESEEAKKVINDFVEKGTQGKIAEAVKKLDQDTVFALANYILFKGKWKKPFDPENTEEAEFHVDESTTVKVPMMTLSGMLHVHHCSTLSSWVLLMDYAGNATAVFLLPDDGKMQHLEQTLSKELISKFLLNRRRRLAQIHFPRLSISGEYNLKTLMSPLGITRIFNNGADLSGITEENAPLKLSQAVHKAVLTIDETGTEAAAVTVLQMVPMSMPPILRFDHPFLFIIFEEHTQSPIFLGKVVDPTHK
-
Predicted Molecular Mass
44.5 kDa
-
Molecular Weight
Approximately 45-60 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
