Serpin B8 Protein, Mouse (sf9, His)

The Serpin B8 protein plays a critical role in promoting epithelial desmosome-mediated intercellular adhesion, underscoring its importance in maintaining cell adhesion within epithelial tissues.The protein's involvement suggests an important contribution to the structural integrity and stability of desmosomes, key cellular structures that mediate adhesion between adjacent cells.Serpin B8 Protein, Mouse (sf9, His) is the recombinant mouse-derived Serpin B8 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Serpin B8, plays a crucial role in epithelial desmosome-mediated cell-cell adhesion. The protein's significance in this context underscores its involvement in maintaining the structural integrity and stability of epithelial tissues through the regulation of desmosomal interactions. As a member of the serine protease inhibitor family, Serpin B8 likely exerts its influence by modulating protease activity, contributing to the intricate balance required for proper cell adhesion. Further exploration of the specific mechanisms and interactions involving Serpin B8 in desmosome-mediated adhesion may provide insights into its broader implications for tissue homeostasis and potentially reveal its relevance in pathological conditions related to epithelial integrity.

Mouse

Sf9 insect cells

C-His

O08800 (M1-P374)

20725  [NCBI]

Full Length

MDDLSEANGSFAISLLKILSEKDKSRNLFFCPMSVSSALAMVYLGAKGNTATQMSEVLGLSGNGDVHQSFQTLLAEINKTDTQYLLKSACRLFGEESCDFLSTFKESCHKFYQAGLEELSFAKDTEGCRKHINDWVSEKTEGKISEVLSPGTVCPLTKLVLVNAMYFKGKWKAQFDRKYTRGMPFKTNQEKKTVQMMFKHAKFKMGHVDEVNMQVLALPYAEEELSMVILLPDESTDLAVVEKALTYEKLRAWTNPETLTESQVQVFLPRLKLEESYDLETVLQNLGMTDAFEETRADFSGMTTKKNVPVSKVAHKCFVEVNEEGTEAAAATAVIRNARCCRTEPRFCADHPFLFFIWHHKTSSILFCGRFSSP

Approximately 43.6 kDa,based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.