Serpin B8 Protein, Mouse (sf9, His)
The Serpin B8 protein plays a critical role in promoting epithelial desmosome-mediated intercellular adhesion, underscoring its importance in maintaining cell adhesion within epithelial tissues.The protein's involvement suggests an important contribution to the structural integrity and stability of desmosomes, key cellular structures that mediate adhesion between adjacent cells.Serpin B8 Protein, Mouse (sf9, His) is the recombinant mouse-derived Serpin B8 protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Mouse
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The Serpin B8 protein plays a critical role in promoting epithelial desmosome-mediated intercellular adhesion, underscoring its importance in maintaining cell adhesion within epithelial tissues.The protein's involvement suggests an important contribution to the structural integrity and stability of desmosomes, key cellular structures that mediate adhesion between adjacent cells.Serpin B8 Protein, Mouse (sf9, His) is the recombinant mouse-derived Serpin B8 protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
Serpin B8, plays a crucial role in epithelial desmosome-mediated cell-cell adhesion. The protein's significance in this context underscores its involvement in maintaining the structural integrity and stability of epithelial tissues through the regulation of desmosomal interactions. As a member of the serine protease inhibitor family, Serpin B8 likely exerts its influence by modulating protease activity, contributing to the intricate balance required for proper cell adhesion. Further exploration of the specific mechanisms and interactions involving Serpin B8 in desmosome-mediated adhesion may provide insights into its broader implications for tissue homeostasis and potentially reveal its relevance in pathological conditions related to epithelial integrity.
Technical Parameters
-
Species Mouse
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
O08800 (M1-P374)
-
Molecular Construction
-
N-term
-
Serpin B8 (M1-P374)
Accession # O08800 -
His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
SERPINB8; Peptidase Inhibitor 8; Prev. PI8; PI-8; CAP2; Protease Inhibitor 8 (Ovalbumin Type); Cytoplasmic Antiproteinase 2; C18orf53; Serine (Or Cysteine) Proteinase Inhibitor, Clade B (Ovalbumin), Member 8; CAP-2; Serpin Peptidase Inhibitor, Clade B (Ov
-
AA Sequence
MDDLSEANGSFAISLLKILSEKDKSRNLFFCPMSVSSALAMVYLGAKGNTATQMSEVLGLSGNGDVHQSFQTLLAEINKTDTQYLLKSACRLFGEESCDFLSTFKESCHKFYQAGLEELSFAKDTEGCRKHINDWVSEKTEGKISEVLSPGTVCPLTKLVLVNAMYFKGKWKAQFDRKYTRGMPFKTNQEKKTVQMMFKHAKFKMGHVDEVNMQVLALPYAEEELSMVILLPDESTDLAVVEKALTYEKLRAWTNPETLTESQVQVFLPRLKLEESYDLETVLQNLGMTDAFEETRADFSGMTTKKNVPVSKVAHKCFVEVNEEGTEAAAATAVIRNARCCRTEPRFCADHPFLFFIWHHKTSSILFCGRFSSP
-
Predicted Molecular Mass
43.6 kDa
-
Molecular Weight
Approximately 44 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
