SFSWAP Protein, Human (His, Strep)
SFSWAP Protein, Human (His, Strep) is the recombinant human-derived SFSWAP, expressed by E. coli , with Strep, His labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
SFSWAP Protein, Human (His, Strep) is the recombinant human-derived SFSWAP, expressed by E. coli , with Strep, His labeled tag. ,
Background
SFSWAP functions as an alternative splicing regulator that modulates its own expression at the RNA processing level. It also regulates the splicing of fibronectin and CD45 genes. The mechanism may involve, at least partially, interaction with other R/S domain-containing splicing factors. Additionally, SFSWAP represses the splicing of MAPT/Tau exon 10. by similar: likely exerts function through interactions with other splicing factors.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Strep;His
-
Accession
Q12872-1 (V189-S282)
-
Gene ID6433
-
Protein Length
Partial
-
Synonyms
SFSWAP; Splicing Factor, Arginine/Serine-Rich 8 (Suppressor-Of-White-Apricot, Drosophila Homolog); Prev. SFRS8; Splicing Factor, Arginine/Serine-Rich 8; SWAP; Splicing Factor, Suppressor Of White-Apricot Homolog (Drosophila); Splicing Factor, Suppressor O
-
AA Sequence
VAPLGLSVPSDVELPPTAKMHAIIERTASFVCRQGAQFEIMLKAKQARNSQFDFLRFDHYLNPYYKFIQKAMKEGRYTVLAENKSDEKKKSGVS
-
Predicted Molecular Mass
13.9 kDa
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
