SFTPA2 Protein, Human (HEK293, hFc)
SFTPA2 (Pulmonary surfactant-associated protein A2) is primarily synthesized in lung alveolar type II cells, as part of a complex of lipids and proteins known as pulmonary surfactant. SFTPA2 Protein, Human (HEK293, hFc) is the recombinant human-derived SFTPA2 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Help & FAQs
Biological Activity
Description
SFTPA2 (Pulmonary surfactant-associated protein A2) is primarily synthesized in lung alveolar type II cells, as part of a complex of lipids and proteins known as pulmonary surfactant. SFTPA2 Protein, Human (HEK293, hFc) is the recombinant human-derived SFTPA2 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
In presence of calcium ions, SFTPA2 (Pulmonary surfactant-associated protein A2) binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
Q8IWL1 (S141-F248)
-
Gene ID729238
-
Molecular Construction
-
N-term
-
SFTPA2 (S141-F248)
Accession # Q8IWL1 -
hFc
-
C-term
-
-
Protein Length
Partial
-
Synonyms
SFTPA2; PSAP; Surfactant Protein A2; PSPA; COLEC5; SP-A; 35 KDa Pulmonary Surfactant-Associated Protein; Surfactant, Pulmonary-Associated Protein A2; Alveolar Proteinosis Protein; Collectin 5; SP-A2; Collectin-5; Surfactant, Pulmonary-Associated Protein A
-
AA Sequence
SNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF
-
Predicted Molecular Mass
41.0 kDa
-
Purity
≥ 85%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O . For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
