Sialidase-2 Protein, Mouse (P.pastoris, His)

Sialidase-2 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Sialidase-2, expressed by P. pastoris , with N-10*His labeled tag. ,

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: P. pastoris
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Sialidase-2 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Sialidase-2, expressed by P. pastoris , with N-10*His labeled tag. ,

Background

Sialidase-2 is an exo-alpha-sialidase that catalyzes the hydrolytic cleavage of terminal sialic acid (N-acetylneuraminic acid, Neu5Ac) during the catabolism of glycolipids, glycoproteins, and oligosaccharides. It recognizes the sialyl linkage positions of the glycan moiety as well as the supramolecular organization of sialoglycoconjugates (By similarity). The enzyme shows a preference for alpha-(2->3)-sialylated GD1a and GT1B gangliosides over alpha-(2->8)-sialylated GD1b, in both monomeric and micellar forms. It exclusively hydrolyzes monomeric GM1 ganglioside but exhibits no activity toward the micellar form (By similarity). Sialidase-2 displays lower sialidase activity for glycoproteins like fetuin and transferrin, which carry a mixture of alpha-(2->3) and alpha-(2->6)-sialyl linkages (By similarity). It cleaves the milk oligosaccharide alpha-(2->3)-sialyllactose but is inactive toward the alpha-(2->6)-sialyllactose isomer and colominic acid, a homopolymer of alpha-(2->8)-linked Neu5Ac residues (By similarity).

Technical Parameters

  • Species Mouse
  • Source P. pastoris
  • Tag N-10*His
  • Accession
  • Gene ID
  • Protein Length

    Full Length

  • Synonyms

    NEU2; Sialidase 2 (Cytosolic Sialidase); Neuraminidase 2; Cytosolic Sialidase; N-Acetyl-Alpha-Neuraminidase 2; Sialidase-2; SIAL2; Neuraminidase 2 (Cytosolic Sialidase)

  • AA Sequence

    MATCPVLQKETLFRTGVHAYRIPALLYLKKQKTLLAFAEKRASKTDEHAELIVLRRGSYNEATNRVKWQPEEVVTQAQLEGHRSMNPCPLYDKQTKTLFLFFIAVPGRVSEHHQLHTKVNVTRLCCVSSTDHGRTWSPIQDLTETTIGSTHQEWATFAVGPGHCLQLRNPAGSLLVPAYAYRKLHPAQKPTPFAFCFISLDHGHTWKLGNFVAENSLECQVAEVGTGAQRMVYLNARSFLGARVQAQSPNDGLDFQDNRVVSKLVEPPHGCHGSVVAFHNPISKPHALDTWLLYTHPTDSRNRTNLGVYLNQMPLDPTAWSEPTLLAMGICAYSDLQNMGQGPDGSPQFGCLYESGNYEEIIFLIFTLKQAFPTVFDAQ

  • Predicted Molecular Mass

    44.9 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00