SIRP alpha/CD172a Protein, Mouse (G365D, HEK293, mFc)

The SIRP α/CD172a protein is an immunoglobulin-like cell surface receptor for CD47 and is essential for the translocation of binding partners to the plasma membrane. It plays a key role in a variety of cellular processes, supporting the adhesion of cerebellar neurons, promoting neurite outgrowth, and promoting glial cell attachment. SIRP alpha/CD172a Protein, Mouse (G365D, HEK293, mFc) is the recombinant mouse-derived SIRP alpha/CD172a protein, expressed by HEK293 , with C-mFc labeled tag and G365D, , , , mutation. The total length of SIRP alpha/CD172a Protein, Mouse (G365D, HEK293, mFc) is 342 a.a., with molecular weight of 90-130 kDa.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The SIRP α/CD172a protein is an immunoglobulin-like cell surface receptor for CD47 and is essential for the translocation of binding partners to the plasma membrane. It plays a key role in a variety of cellular processes, supporting the adhesion of cerebellar neurons, promoting neurite outgrowth, and promoting glial cell attachment. SIRP alpha/CD172a Protein, Mouse (G365D, HEK293, mFc) is the recombinant mouse-derived SIRP alpha/CD172a protein, expressed by HEK293 , with C-mFc labeled tag and G365D, , , , mutation. The total length of SIRP alpha/CD172a Protein, Mouse (G365D, HEK293, mFc) is 342 a.a., with molecular weight of 90-130 kDa.

Background

SIRP alpha/CD172a Protein functions as an immunoglobulin-like cell surface receptor for CD47, facilitating the translocation of PTPN6, PTPN11, and other binding partners from the cytosol to the plasma membrane. This receptor plays a crucial role in various cellular processes, including supporting adhesion of cerebellar neurons, promoting neurite outgrowth, and facilitating glial cell attachment. Additionally, SIRP alpha/CD172a is implicated in intracellular signaling during synaptogenesis and synaptic function. Its negative regulatory role extends to receptor tyrosine kinase-coupled responses induced by cell adhesion, growth factors, or insulin. Furthermore, SIRP alpha/CD172a participates in the negative modulation of phagocytosis, mast cell activation, and dendritic cell activation, with CD47 binding preventing dendritic cell maturation and inhibiting cytokine production. Notably, it contributes to antiviral immunity by limiting new world arenavirus infection, specifically by decreasing virus internalization. The receptor also interacts with THBS1, participating in ROS signaling in non-phagocytic cells and stimulating NADPH oxidase-derived ROS production. SIRP alpha/CD172a engages in diverse protein interactions, including binding to PTPN11, GRB2, FGR, JAK2, SCAP1, SCAP2, FYB1, PTK2B, and TRIM2.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-mFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD172a (K32-N373, G365D)
      Accession # P97797-1
    • mFc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    SIRPA; MYD1; Prev. PTPNS1; Brain-Immunoglobulin-Like Molecule With Tyrosine-Based Activation Motifs; SHPS1; Brain Ig-Like Molecule With Tyrosine-Based Activation Motifs; SIRP; Protein Tyrosine Phosphatase, Non-Receptor Type Substrate 1; BIT; Tyrosine Phos

  • AA Sequence

    KELKVTQPEKSVSVAAGDSTVLNCTLTSLLPVGPIRWYRGVGPSRLLIYSFAGEYVPRIRNVSDTTKRNNMDFSIRISNVTPADAGIYYCVKFQKGSSEPDTEIQSGGGTEVYVLAKPSPPEVSGPADRGIPDQKVNFTCKSHGFSPRNITLKWFKDGQELHPLETTVNPSGKNVSYNISSTVRVVLNSMDVNSKVICEVAHITLDRSPLRGIANLSNFIRVSPTVKVTQQSPTSMNQVNLTCRAERFYPEDLQLIWLENGNVSRNDTPKNLTKNTDGTYNYTSLFLVNSSAHREDVVFTCQVKHDQQPAITRNHTVLGFAHSSDQGSMQTFPDNNATHNWN

  • Predicted Molecular Mass

    65 kDa

  • Molecular Weight

    Approximately 90-130 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<0.1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00