1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Dendritic Cell CD Proteins Cell Adhesion Molecules (CAMs)
  4. SIRP alpha/CD172a Immunoglobulin-like Cell Adhesion Molecules
  5. SIRP alpha/CD172a Protein, Mouse (G365D, HEK293, mFc)

SIRP alpha/CD172a Protein, Mouse (G365D, HEK293, mFc)

Cat. No.: HY-P78661
Handling Instructions Technical Support

The SIRP α/CD172a protein is an immunoglobulin-like cell surface receptor for CD47 and is essential for the translocation of binding partners to the plasma membrane. It plays a key role in a variety of cellular processes, supporting the adhesion of cerebellar neurons, promoting neurite outgrowth, and promoting glial cell attachment. SIRP alpha/CD172a Protein, Mouse (G365D, HEK293, mFc) is the recombinant mouse-derived SIRP alpha/CD172a protein, expressed by HEK293 , with C-mFc labeled tag and G365D, , , , mutation. The total length of SIRP alpha/CD172a Protein, Mouse (G365D, HEK293, mFc) is 342 a.a., with molecular weight of 90-130 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
100 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The SIRP α/CD172a protein is an immunoglobulin-like cell surface receptor for CD47 and is essential for the translocation of binding partners to the plasma membrane. It plays a key role in a variety of cellular processes, supporting the adhesion of cerebellar neurons, promoting neurite outgrowth, and promoting glial cell attachment. SIRP alpha/CD172a Protein, Mouse (G365D, HEK293, mFc) is the recombinant mouse-derived SIRP alpha/CD172a protein, expressed by HEK293 , with C-mFc labeled tag and G365D, , , , mutation. The total length of SIRP alpha/CD172a Protein, Mouse (G365D, HEK293, mFc) is 342 a.a., with molecular weight of 90-130 kDa.

Background

SIRP alpha/CD172a Protein functions as an immunoglobulin-like cell surface receptor for CD47, facilitating the translocation of PTPN6, PTPN11, and other binding partners from the cytosol to the plasma membrane. This receptor plays a crucial role in various cellular processes, including supporting adhesion of cerebellar neurons, promoting neurite outgrowth, and facilitating glial cell attachment. Additionally, SIRP alpha/CD172a is implicated in intracellular signaling during synaptogenesis and synaptic function. Its negative regulatory role extends to receptor tyrosine kinase-coupled responses induced by cell adhesion, growth factors, or insulin. Furthermore, SIRP alpha/CD172a participates in the negative modulation of phagocytosis, mast cell activation, and dendritic cell activation, with CD47 binding preventing dendritic cell maturation and inhibiting cytokine production. Notably, it contributes to antiviral immunity by limiting new world arenavirus infection, specifically by decreasing virus internalization. The receptor also interacts with THBS1, participating in ROS signaling in non-phagocytic cells and stimulating NADPH oxidase-derived ROS production. SIRP alpha/CD172a engages in diverse protein interactions, including binding to PTPN11, GRB2, FGR, JAK2, SCAP1, SCAP2, FYB1, PTK2B, and TRIM2.

Biological Activity

Immobilized Mouse SIRP alpha mFc at 2 μg/mL (100 μL/well) can bind Mouse CD47 Fc with a linear range of 8-63 ng/mL.

Species

Mouse

Source

HEK293

Tag

C-mFc

Accession

P97797-1 (K32-N373, G365D)

Gene ID
Molecular Construction
N-term
CD172a (K32-N373, G365D)
Accession # P97797-1
mFc
C-term
Protein Length

Extracellular Domain

Synonyms
SHPS1; SIRPA; CD172A; BIT; MFR; MYD1; P84; PTPNS1
AA Sequence

KELKVTQPEKSVSVAAGDSTVLNCTLTSLLPVGPIRWYRGVGPSRLLIYSFAGEYVPRIRNVSDTTKRNNMDFSIRISNVTPADAGIYYCVKFQKGSSEPDTEIQSGGGTEVYVLAKPSPPEVSGPADRGIPDQKVNFTCKSHGFSPRNITLKWFKDGQELHPLETTVNPSGKNVSYNISSTVRVVLNSMDVNSKVICEVAHITLDRSPLRGIANLSNFIRVSPTVKVTQQSPTSMNQVNLTCRAERFYPEDLQLIWLENGNVSRNDTPKNLTKNTDGTYNYTSLFLVNSSAHREDVVFTCQVKHDQQPAITRNHTVLGFAHSSDQGSMQTFPDNNATHNWN

Molecular Weight

90-130 kDa

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of 50 mM Tris, 100 mM Glycine, pH 7.5. Normally trehalose is added as protectant before lyophilization.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<0.1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

SIRP alpha/CD172a Protein, Mouse (G365D, HEK293, mFc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SIRP alpha/CD172a Protein, Mouse (G365D, HEK293, mFc)
Cat. No.:
HY-P78661
Quantity:
MCE Japan Authorized Agent: