1. Recombinant Proteins
  2. Others
  3. SLC16A2 Protein, Human (sf9, His, MBP, FLAG)

The SLC16A2 protein is a specific thyroid hormone transmembrane transporter that promotes bidirectional movement of thyroid hormone across cell membranes independent of pH or Na(+) gradients. SLC16A2 has a significant preference for substrates such as T3 and T4 and is a key mediator of thyroid hormone transport. SLC16A2 Protein, Human (sf9, His, MBP, FLAG) is the recombinant human-derived SLC16A2 protein, expressed by sf9 insect cells , with N-MBP, C-Flag, N-8*His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Stock
50 μg   Obtener un presupuesto  
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

  • Referencias

Descripciòn

The SLC16A2 protein is a specific thyroid hormone transmembrane transporter that promotes bidirectional movement of thyroid hormone across cell membranes independent of pH or Na(+) gradients. SLC16A2 has a significant preference for substrates such as T3 and T4 and is a key mediator of thyroid hormone transport. SLC16A2 Protein, Human (sf9, His, MBP, FLAG) is the recombinant human-derived SLC16A2 protein, expressed by sf9 insect cells , with N-MBP, C-Flag, N-8*His labeled tag.

Background

SLC16A2, a specific thyroid hormone transmembrane transporter, plays a pivotal role in facilitating the uptake and efflux of thyroid hormones across the cell membrane, operating independently of pH or a Na(+) gradient. With a notable preference for substrates such as the iodothyronines T3 and T4, and to a lesser extent rT3 and 3,3-diiodothyronine (3,3'-T2), SLC16A2 emerges as a key mediator of thyroid hormone transport. Its significance is particularly pronounced in the transport of T3, notably through the blood-brain barrier, emphasizing its crucial role in enabling the entry of thyroid hormones into the brain. The transporter's ability to translocate thyroid hormones underscores its importance in regulating the cellular availability of these essential molecules, highlighting its impact on thyroid hormone homeostasis and its potential therapeutic relevance in various physiological contexts.

Species

Human

Source

Sf9 insect cells

Tag

N-MBP;C-Flag;N-8*His

Accession

P36021 (A2-I539)

Gene ID

6567

Molecular Construction
N-term
8*His-MBP
SLC16A2 (A2-I539)
Accession # P36021
Flag
C-term
Protein Length

Full Length of Mature Protein

Synonyms
SLC16A2; Monocarboxylate transporter 8; MCT 8; Monocarboxylate transporter 7; MCT 7; Solute carrier family 16 member 2; X-linked PEST-containing transporter
AA Sequence

ALQSQASEEAKGPWQEADQEQQEPVGSPEPESEPEPEPEPEPVPVPPPEPQPEPQPLPDPAPLPELEFESERVHEPEPTPTVETRGTARGFQPPEGGFGWVVVFAATWCNGSIFGIHNSVGILYSMLLEEEKEKNRQVEFQAAWVGALAMGMIFFCSPIVSIFTDRLGCRITATAGAAVAFIGLHTSSFTSSLSLRYFTYGILFGCGCSFAFQPSLVILGHYFQRRLGLANGVVSAGSSIFSMSFPFLIRMLGDKIKLAQTFQVLSTFMFVLMLLSLTYRPLLPSSQDTPSKRGVRTLHQRFLAQLRKYFNMRVFRQRTYRIWAFGIAAAALGYFVPYVHLMKYVEEEFSEIKETWVLLVCIGATSGLGRLVSGHISDSIPGLKKIYLQVLSFLLLGLMSMMIPLCRDFGGLIVVCLFLGLCDGFFITIMAPIAFELVGPMQASQAIGYLLGMMALPMIAGPPIAGLLRNCFGDYHVAFYFAGVPPIIGAVILFFVPLMHQRMFKKEQRDSSKDKMLAPDPDPNGELLPGSPNPEEPI

Pureza

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentación
Referencias

SLC16A2 Protein, Human (sf9, His, MBP, FLAG) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

SLC16A2 Protein, Human (sf9, His, MBP, FLAG)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
SLC16A2 Protein, Human (sf9, His, MBP, FLAG)
Cat. No.:
HY-P702021
Cantidad:
MCE Japan Authorized Agent: