SLC16A2 Protein, Human (sf9, His, MBP, FLAG)
The SLC16A2 protein is a specific thyroid hormone transmembrane transporter that promotes bidirectional movement of thyroid hormone across cell membranes independent of pH or Na(+) gradients. SLC16A2 has a significant preference for substrates such as T3 and T4 and is a key mediator of thyroid hormone transport. SLC16A2 Protein, Human (sf9, His, MBP, FLAG) is the recombinant human-derived SLC16A2 protein, expressed by sf9 insect cells , with N-MBP, C-Flag, N-8*His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The SLC16A2 protein is a specific thyroid hormone transmembrane transporter that promotes bidirectional movement of thyroid hormone across cell membranes independent of pH or Na(+) gradients. SLC16A2 has a significant preference for substrates such as T3 and T4 and is a key mediator of thyroid hormone transport. SLC16A2 Protein, Human (sf9, His, MBP, FLAG) is the recombinant human-derived SLC16A2 protein, expressed by sf9 insect cells , with N-MBP, C-Flag, N-8*His labeled tag.
Background
SLC16A2, a specific thyroid hormone transmembrane transporter, plays a pivotal role in facilitating the uptake and efflux of thyroid hormones across the cell membrane, operating independently of pH or a Na(+) gradient. With a notable preference for substrates such as the iodothyronines T3 and T4, and to a lesser extent rT3 and 3,3-diiodothyronine (3,3'-T2), SLC16A2 emerges as a key mediator of thyroid hormone transport. Its significance is particularly pronounced in the transport of T3, notably through the blood-brain barrier, emphasizing its crucial role in enabling the entry of thyroid hormones into the brain. The transporter's ability to translocate thyroid hormones underscores its importance in regulating the cellular availability of these essential molecules, highlighting its impact on thyroid hormone homeostasis and its potential therapeutic relevance in various physiological contexts.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-MBP;C-Flag;N-8*His
-
Accession
P36021 (A2-I539)
-
Gene ID6567
-
Molecular Construction
-
N-term
-
8*His-MBP
-
SLC16A2 (A2-I539)
Accession # P36021 -
Flag
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
SLC16A2; DXS128E; Prev. DXS128; Monocarboxylate Transporter 7; Prev. MRX22; MCT 7; Prev. AHDS; MCT 8; XPCT; Solute Carrier Family 16 (Monocarboxylic Acid Transporters), Member 2 (Putative Transporter); MCT8; Solute Carrier Family 16, Member 2 (Monocarboxy
-
AA Sequence
ALQSQASEEAKGPWQEADQEQQEPVGSPEPESEPEPEPEPEPVPVPPPEPQPEPQPLPDPAPLPELEFESERVHEPEPTPTVETRGTARGFQPPEGGFGWVVVFAATWCNGSIFGIHNSVGILYSMLLEEEKEKNRQVEFQAAWVGALAMGMIFFCSPIVSIFTDRLGCRITATAGAAVAFIGLHTSSFTSSLSLRYFTYGILFGCGCSFAFQPSLVILGHYFQRRLGLANGVVSAGSSIFSMSFPFLIRMLGDKIKLAQTFQVLSTFMFVLMLLSLTYRPLLPSSQDTPSKRGVRTLHQRFLAQLRKYFNMRVFRQRTYRIWAFGIAAAALGYFVPYVHLMKYVEEEFSEIKETWVLLVCIGATSGLGRLVSGHISDSIPGLKKIYLQVLSFLLLGLMSMMIPLCRDFGGLIVVCLFLGLCDGFFITIMAPIAFELVGPMQASQAIGYLLGMMALPMIAGPPIAGLLRNCFGDYHVAFYFAGVPPIIGAVILFFVPLMHQRMFKKEQRDSSKDKMLAPDPDPNGELLPGSPNPEEPI
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
