SLC26A9 Protein, Human (HEK293)
SLC26A9 Protein, Human (HEK293) is the recombinant human-derived SLC26A9, expressed by HEK293 , with tag Free labeled tag. ,
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
SLC26A9 Protein, Human (HEK293) is the recombinant human-derived SLC26A9, expressed by HEK293 , with tag Free labeled tag. ,
Background
SLC26A9 is an ion transporter that functions both as an ion channel and an anion exchanger. It primarily acts as a chloride channel, mediating uncoupled chloride transport via an alternate-access mechanism where a saturable binding site is alternately exposed to either side of the membrane. Additionally, it serves as a DIDS- and thiosulfate-sensitive anion exchanger, facilitating the exchange of chloride for bicarbonate ions across the cell membrane.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
Q7LBE3-1 (M1-L791)
-
Gene ID115019
-
Protein Length
Full Length of Isoform-1
-
Synonyms
SLC26A9; Anion Transporter/Exchanger Protein 9; Solute Carrier Family 26 Member 9; Anion Transporter/Exchanger-9; Solute Carrier Family 26 (Anion Exchanger), Member 9; Solute Carrier Family 26, Member 9
-
AA Sequence
MSQPRPRYVVDRAAYSLTLFDDEFEKKDRTYPVGEKLRNAFRCSSAKIKAVVFGLLPVLSWLPKYKIKDYIIPDLLGGLSGGSIQVPQGMAFALLANLPAVNGLYSSFFPLLTYFFLGGVHQMVPGTFAVISILVGNICLQLAPESKFQVFNNATNESYVDTAAMEAERLHVSATLACLTAIIQMGLGFMQFGFVAIYLSESFIRGFMTAAGLQILISVLKYIFGLTIPSYTGPGSIVFTFIDICKNLPHTNIASLIFALISGAFLVLVKELNARYMHKIRFPIPTEMIVVVVATAISGGCKMPKKYHMQIVGEIQRGFPTPVSPVVSQWKDMIGTAFSLAIVSYVINLAMGRTLANKHGYDVDSNQEMIALGCSNFFGSFFKIHVICCALSVTLAVDGAGGKSQVASLCVSLVVMITMLVLGIYLYPLPKSVLGALIAVNLKNSLKQLTDPYYLWRKSKLDCCIWVVSFLSSFFLSLPYGVAVGVAFSVLVVVFQTQFRNGYALAQVMDTDIYVNPKTYNRAQDIQGIKIITYCSPLYFANSEIFRQKVIAKTGMDPQKVLLAKQKYLKKQEKRRMRPTQQRRSLFMKTKTVSLQELQQDFENAPPTDPNNNQTPANGTSVSYITFSPDSSSPAQSEPPASAEAPGEPSDMLASVPPFVTFHTLILDMSGVSFVDLMGIKALAKLSSTYGKIGVKVFLVNIHAQVYNDISHGGVFEDGSLECKHVFPSIHDAVLFAQANARDVTPGHNFQGAPGDAELSLYDSEEDIRSYWDLEQEMFGSMFHAETLTAL
-
Predicted Molecular Mass
87.1 kDa
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
