SLC30A2 Protein, Human (sf9, His, MBP, FLAG)
The SLC30A2 protein acts as an electrically neutral proton-coupled antiporter, transporting zinc ions into various intracellular organelles. SLC30A2 Protein, Human (sf9, His, MBP, FLAG) is the recombinant human-derived SLC30A2 protein, expressed by sf9 insect cells , with N-MBP, C-Flag, N-8*His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The SLC30A2 protein acts as an electrically neutral proton-coupled antiporter, transporting zinc ions into various intracellular organelles. SLC30A2 Protein, Human (sf9, His, MBP, FLAG) is the recombinant human-derived SLC30A2 protein, expressed by sf9 insect cells , with N-MBP, C-Flag, N-8*His labeled tag.
Background
SLC30A2 Protein serves as an essential electroneutral proton-coupled antiporter, facilitating the concentration of zinc ions into various intracellular organelles, including endosomes, zymogen granules, and mitochondria. This pivotal function plays a crucial role in maintaining cellular zinc homeostasis, providing protection against the potential cytotoxic effects of excess zinc. In addition to its intracellular role, SLC30A2 regulates the zinc concentration in milk by transporting zinc ions into secretory vesicles of mammary cells. The protein's involvement in concentrating zinc ions into lysosomes is linked to lysosomal-mediated cell death during early mammary gland involution. Furthermore, SLC30A2 acts as an electroneutral proton-coupled antiporter that mediates the efflux of zinc ions through the plasma membrane, underscoring its multifaceted role in zinc transport across various cellular compartments.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-MBP;C-Flag;N-8*His
-
Accession
Q9BRI3-1 (E2-D323)
-
Gene ID7780
-
Molecular Construction
-
N-term
-
8*His-MBP
-
SLC30A2 (E2-D323)
Accession # Q9BRI3-1 -
Flag
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
SLC30A2; Zinc Transporter 2; Prev. ZNT2; PP12488; Solute Carrier Family 30 (Zinc Transporter), Member 2; TNZD; Proton-Coupled Zinc Antiporter SLC30A2; Solute Carrier Family 30 Member 2; ZnT-2
-
AA Sequence
EAKEKQHLLDARPAIRSYTGSLWQEGAGWIPLPRPGLDLQAIELAAQSNHHCHAQKGPDSHCDPKKGKAQRQLYVASAICLLFMIGEVVEILGALVSVLSIWVVTGVLVYLAVERLISGDYEIDGGTMLITSGCAVAVNIIMGLTLHQSGHGHSHGTTNQQEENPSVRAAFIHVIGDFMQSMGVLVAAYILYFKPEYKYVDPICTFVFSILVLGTTLTILRDVILVLMEGTPKGVDFTAVRDLLLSVEGVEALHSLHIWALTVAQPVLSVHIAIAQNTDAQAVLKTASSRLQGKFHFHTVTIQIEDYSEDMKDCQACQGPSD
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
