SLC34A2 Protein, Human (HEK293, His, mFc)
SLC34A2 Protein, Human (HEK293, His, mFc) is the recombinant human-derived SLC34A2 protein, expressed by HEK293, with N-10*His & C-mFc tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
SLC34A2 Protein, Human (HEK293, His, mFc) is the recombinant human-derived SLC34A2 protein, expressed by HEK293, with N-10*His & C-mFc tag.
Background
SLC34A2 is a transporter protein that actively transports phosphate into cells via Na(+) cotransport.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-10*His;C-mFc
-
Accession
O95436-1 (V234-L362)
-
Gene ID10568
-
Molecular Construction
-
N-term
-
10*His
-
SLC34A2 (V243-L362)
Accession # O95436-1 -
mFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
SLC34A2; Solute Carrier Family 34 (Type II Sodium/Phosphate Cotransporter), Member 2; Solute Carrier Family 34 Member 2; Solute Carrier Family 34 (Sodium Phosphate), Member 2; Sodium-Dependent Phosphate Transport Protein 2B; Na(+)-Dependent Phosphate Cotr
-
AA Sequence
VEVATHYLEIITQLIVESFHFKNGEDAPDLLKVITKPFTKLIVQLDKKVISQIAMNDEKAKNKSLVKIWCKTFTNKTQINVTVPSTANCTSPSLCWTDGIQNWTMKNVTYKENIAKCQHIFVNFHLPDL
-
Predicted Molecular Mass
45.5 kDa
-
Molecular Weight
Approximately 66 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
