SLC51B Protein, Human (sf9, His, MBP, FLAG)
The SLC51B protein is an important component of the Ost-α/Ost-β complex, which transports bile acids from enterocytes to portal blood. SLC51B Protein, Human (sf9, His, MBP, FLAG) is the recombinant human-derived SLC51B protein, expressed by sf9 insect cells , with N-MBP, C-Flag, N-8*His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The SLC51B protein is an important component of the Ost-α/Ost-β complex, which transports bile acids from enterocytes to portal blood. SLC51B Protein, Human (sf9, His, MBP, FLAG) is the recombinant human-derived SLC51B protein, expressed by sf9 insect cells , with N-MBP, C-Flag, N-8*His labeled tag.
Background
SLC51B emerges as an indispensable element within the Ost-alpha/Ost-beta complex, a dynamic heterodimer pivotal in facilitating bile acid export from enterocytes into the portal blood. This transporter duo, comprising Ost-alpha and Ost-beta, demonstrates remarkable efficacy in transporting various bile acids, with taurocholate being a prominent substrate. SLC51B's involvement extends beyond bile acid transport; it plays a crucial role in modulating the glycosylation, membrane trafficking, and stability of its partner SLC51A. The Ost-alpha/Ost-beta complex doesn't limit its repertoire to bile acids alone; it showcases versatility by efficiently transporting taurine-conjugated bile acids over their glycine-conjugated counterparts. Impressively, SLC51B exhibits proficiency in transporting steroids, including estrone 3-sulfate and dehydroepiandrosterone 3-sulfate, thereby contributing to the enterohepatic circulation of sterols. Furthermore, its capacity to transport eicosanoids, such as prostaglandin E2, adds another layer to its multifaceted role in cellular transport processes.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-MBP;C-Flag;N-8*His
-
Accession
Q86UW2 (E2-S128)
-
Gene ID123264
-
Molecular Construction
-
N-term
-
8*His-MBP
-
SLC51B (E2-S128)
Accession # Q86UW2 -
Flag
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
SLC51B; Organic Solute Transporter Subunit Beta; SLC51 Subunit Beta; SLC51A1 Binding Protein; Solute Carrier Family 51 Subunit Beta; OST-Beta; SLC51A1BP; OSTB; OSTbeta; Solute Carrier Family 51 Beta Subunit; Organic Solute Transporter Beta Subunit; PBAM2
-
AA Sequence
EHSEGAPGDPAGTVVPQELLEEMLWFFRVEDASPWNHSILALAAVVVIISMVLLGRSIQASRKEKMQPPEKETPEVLHLDEAKDHNSLNNLRETLLSEKPNLAQVELELKERDVLSVFLPDVPETES
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)