SLITRK6 Protein, Human (Biotinylated, HEK293, His-Avi)
The SLITRK6 protein is a key regulator that coordinates neurite growth, which is critical for normal hearing and vision, affecting neuronal development and intercellular communication. Its importance in sensory function emphasizes its important role in the molecular mechanisms of sensory perception. SLITRK6, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived SLITRK6 protein, expressed by HEK293, with N-Avi labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The SLITRK6 protein is a key regulator that coordinates neurite growth, which is critical for normal hearing and vision, affecting neuronal development and intercellular communication. Its importance in sensory function emphasizes its important role in the molecular mechanisms of sensory perception. SLITRK6, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived SLITRK6 protein, expressed by HEK293, with N-Avi labeled tag.
Background
SLITRK6 emerges as a key regulator in the intricate orchestration of neurite outgrowth, playing a crucial role in maintaining normal hearing and vision. This protein's influence extends to the intricate processes involved in neuronal development, particularly in the growth of neurites, which are essential structures for intercellular communication. The significance of SLITRK6 in sensory functions, such as hearing and vision, emphasizes its importance in the intricate network of molecular mechanisms that underlie sensory perception. As a regulator of neurite outgrowth, SLITRK6 contributes to the establishment and maintenance of neuronal connections critical for proper sensory processing, shedding light on its vital role in neural development and sensory function.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-His
-
Accession
Q9H5Y7 (S27-S608)
-
Gene ID84189
-
Molecular Construction
-
N-term
-
SLITRK6 (S27-S608)
Accession # Q9H5Y7 -
His-Avi
-
C-term
-
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
SLITRK6; SLIT And NTRK-Like Family, Member 6; SLIT And NTRK Like Family Member 6; Slit And Trk Like Gene 6; SLIT And NTRK-Like Protein 6; 4832410J21Rik; FLJ22774; DFNMYP
-
AA Sequence
SRGSCDSLCNCEEKDGTMLINCEAKGIKMVSEISVPPSRPFQLSLLNNGLTMLHTNDFSGLTNAISIHLGFNNIADIEIGAFNGLGLLKQLHINHNSLEILKEDTFHGLENLEFLQADNNFITVIEPSAFSKLNRLKVLILNDNAIESLPPNIFRFVPLTHLDLRGNQLQTLPYVGFLEHIGRILDLQLEDNKWACNCDLLQLKTWLENMPPQSIIGDVVCNSPPFFKGSILSRLKKESICPTPPVYEEHEDPSGSLHLAATSSINDSRMSTKTTSILKLPTKAPGLIPYITKPSTQLPGPYCPIPCNCKVLSPSGLLIHCQERNIESLSDLRPPPQNPRKLILAGNIIHSLMKSDLVEYFTLEMLHLGNNRIEVLEEGSFMNLTRLQKLYLNGNHLTKLSKGMFLGLHNLEYLYLEYNAIKEILPGTFNPMPKLKVLYLNNNLLQVLPPHIFSGVPLTKVNLKTNQFTHLPVSNILDDLDLLTQIDLEDNPWDCSCDLVGLQQWIQKLSKNTVTDDILCTSPGHLDKKELKALNSEILCPGLVNNPSMPTQTSYLMVTTPATTTNTADTILRSLTDAVPLS
-
Predicted Molecular Mass
68.4 kDa
-
Molecular Weight
Approximately 80-90 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
