SOCS3 Protein, Human (His-Trx)
Based on 1 Customer Validation
SOCS3 is a member of the SOCS family that operates in a negative feedback loop to regulate cytokine signaling, particularly in the JAK/STAT pathway. It inhibits cytokine signaling by binding to receptors such as IL6ST/gp130, LIF, erythropoietin, insulin, IL12, GCSF, and leptin receptors. SOCS3 Protein, Human (His-Trx) is the recombinant human-derived SOCS3 protein, expressed by E. coli , with N-Trx, N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
SOCS3 is a member of the SOCS family that operates in a negative feedback loop to regulate cytokine signaling, particularly in the JAK/STAT pathway. It inhibits cytokine signaling by binding to receptors such as IL6ST/gp130, LIF, erythropoietin, insulin, IL12, GCSF, and leptin receptors. SOCS3 Protein, Human (His-Trx) is the recombinant human-derived SOCS3 protein, expressed by E. coli , with N-Trx, N-His labeled tag.
Background
SOCS3, a member of the SOCS family, operates within a classical negative feedback system that intricately regulates cytokine signal transduction. Particularly, SOCS3 exerts its influence on the JAK/STAT pathway, engaging in the negative regulation of cytokines. By binding to tyrosine kinase receptors such as IL6ST/gp130, LIF, erythropoietin, insulin, IL12, GCSF, and leptin receptors, SOCS3 effectively inhibits cytokine signal transduction. Notably, its interaction with JAK2 hampers the kinase activity of the latter, thereby modulating IL6 signaling. Beyond its role in signal transduction, SOCS3 plays a critical part in suppressing fetal liver erythropoiesis and regulating the initiation and sustenance of allergic responses mediated by T-helper type 2 cells. Moreover, it serves as a probable substrate recognition component within a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex, facilitating the ubiquitination and subsequent proteasomal degradation of target proteins—an aspect integral to protein modification and ubiquitination processes.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-Trx;N-His
-
Accession
O14543 (M1-L225)
-
Protein Length
Full Length
-
Synonyms
SOCS3; Cish3; Suppressor Of Cytokine Signaling 3; STAT-Induced STAT Inhibitor 3; SOCS-3; SSI3; SSI-3; ATOD4; CIS3; CIS-3; Cytokine-Inducible SH2 Protein 3
-
AA Sequence
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
-
Predicted Molecular Mass
41.9 kDa
-
Molecular Weight
Approximately 46 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, pH 8.0, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)