SOCS3 Protein, Human (His-Trx)

Customer Review

Based on 1 Customer Validation

SOCS3 is a member of the SOCS family that operates in a negative feedback loop to regulate cytokine signaling, particularly in the JAK/STAT pathway. It inhibits cytokine signaling by binding to receptors such as IL6ST/gp130, LIF, erythropoietin, insulin, IL12, GCSF, and leptin receptors. SOCS3 Protein, Human (His-Trx) is the recombinant human-derived SOCS3 protein, expressed by E. coli , with N-Trx, N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

SOCS3 is a member of the SOCS family that operates in a negative feedback loop to regulate cytokine signaling, particularly in the JAK/STAT pathway. It inhibits cytokine signaling by binding to receptors such as IL6ST/gp130, LIF, erythropoietin, insulin, IL12, GCSF, and leptin receptors. SOCS3 Protein, Human (His-Trx) is the recombinant human-derived SOCS3 protein, expressed by E. coli , with N-Trx, N-His labeled tag.

Background

SOCS3, a member of the SOCS family, operates within a classical negative feedback system that intricately regulates cytokine signal transduction. Particularly, SOCS3 exerts its influence on the JAK/STAT pathway, engaging in the negative regulation of cytokines. By binding to tyrosine kinase receptors such as IL6ST/gp130, LIF, erythropoietin, insulin, IL12, GCSF, and leptin receptors, SOCS3 effectively inhibits cytokine signal transduction. Notably, its interaction with JAK2 hampers the kinase activity of the latter, thereby modulating IL6 signaling. Beyond its role in signal transduction, SOCS3 plays a critical part in suppressing fetal liver erythropoiesis and regulating the initiation and sustenance of allergic responses mediated by T-helper type 2 cells. Moreover, it serves as a probable substrate recognition component within a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex, facilitating the ubiquitination and subsequent proteasomal degradation of target proteins—an aspect integral to protein modification and ubiquitination processes.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-Trx;N-His
  • Accession
  • Gene ID
  • Protein Length

    Full Length

  • Synonyms

    SOCS3; Cish3; Suppressor Of Cytokine Signaling 3; STAT-Induced STAT Inhibitor 3; SOCS-3; SSI3; SSI-3; ATOD4; CIS3; CIS-3; Cytokine-Inducible SH2 Protein 3

  • AA Sequence

    MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL

  • Predicted Molecular Mass

    41.9 kDa

  • Molecular Weight

    Approximately 46 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, pH 8.0, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00