1. Recombinant Proteins
  2. Others
  3. SOCS3 Protein, Human (His-Trx)

SOCS3 is a member of the SOCS family that operates in a negative feedback loop to regulate cytokine signaling, particularly in the JAK/STAT pathway. It inhibits cytokine signaling by binding to receptors such as IL6ST/gp130, LIF, erythropoietin, insulin, IL12, GCSF, and leptin receptors. SOCS3 Protein, Human (His-Trx) is the recombinant human-derived SOCS3 protein, expressed by E. coli , with N-Trx, N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg Get quote
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SOCS3 is a member of the SOCS family that operates in a negative feedback loop to regulate cytokine signaling, particularly in the JAK/STAT pathway. It inhibits cytokine signaling by binding to receptors such as IL6ST/gp130, LIF, erythropoietin, insulin, IL12, GCSF, and leptin receptors. SOCS3 Protein, Human (His-Trx) is the recombinant human-derived SOCS3 protein, expressed by E. coli , with N-Trx, N-His labeled tag.

Background

SOCS3, a member of the SOCS family, operates within a classical negative feedback system that intricately regulates cytokine signal transduction. Particularly, SOCS3 exerts its influence on the JAK/STAT pathway, engaging in the negative regulation of cytokines. By binding to tyrosine kinase receptors such as IL6ST/gp130, LIF, erythropoietin, insulin, IL12, GCSF, and leptin receptors, SOCS3 effectively inhibits cytokine signal transduction. Notably, its interaction with JAK2 hampers the kinase activity of the latter, thereby modulating IL6 signaling. Beyond its role in signal transduction, SOCS3 plays a critical part in suppressing fetal liver erythropoiesis and regulating the initiation and sustenance of allergic responses mediated by T-helper type 2 cells. Moreover, it serves as a probable substrate recognition component within a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex, facilitating the ubiquitination and subsequent proteasomal degradation of target proteins—an aspect integral to protein modification and ubiquitination processes.

Species

Human

Source

E. coli

Tag

N-Trx;N-His

Accession

O14543 (M1-L225)

Gene ID
Protein Length

Full Length

Synonyms
Suppressor of cytokine signaling 3; SOCS-3; CIS-3; SSI-3
AA Sequence

MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL

Predicted Molecular Mass
41.9 kDa
Molecular Weight

Approximately 46 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, pH 8.0, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SOCS3 Protein, Human (His-Trx) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

SOCS3 Protein, Human (His-Trx)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SOCS3 Protein, Human (His-Trx)
Cat. No.:
HY-P73633
Quantity:
MCE Japan Authorized Agent: