1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. srtA Protein, S. aureus

srtA Protein, S. aureus is the recombinant srtA protein, expressed by E. coli, with tag free tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

srtA Protein, S. aureus is the recombinant srtA protein, expressed by E. coli, with tag free tag.

Background

srtA is a transpeptidase that anchors surface proteins to the cell wall. It recognizes and modifies its substrate by proteolytic cleavage of a C-terminal sorting signal, forming a covalent intermediate via a thioester bond between the sortase and its substrate, which is then transferred and attached to the cell wall. This enzyme cleaves the Leu-Pro-x-Thr-Gly (LPXTG) motif between the threonine and glycine residues and utilizes lipid II as the peptidoglycan substrate for the sorting reaction. It is responsible for displaying virulence factors and plays a key role in host interactions and colonization during infection. by similar: This function is consistently reported across multiple studies.

Species

Others

Source

E. coli

Tag

Tag Free

Accession

Q2FV99 (Q60-K206, P94S, D160N, D165A, G167E, K196T)

Gene ID

3921273

Protein Length

Partial

Synonyms
Sortase A; Surface protein sorting A; srtA; Staphylococcus aureus (strain NCTC 8325 / PS 47); Hydrolase; Protease; Thiol protease; 3.4.22.70
AA Sequence

QAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATSEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRNVKPTAVEVLDEQKGKDKQLTLITCDDYNEKTGVWETRKIFVATEVK

Predicted Molecular Mass
17 kDa
Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 8.0, 500 mM NaCl, 5% glycerol.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

srtA Protein, S. aureus Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

srtA Protein, S. aureus

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
srtA Protein, S. aureus
Cat. No.:
HY-P703433
Quantity:
MCE Japan Authorized Agent: