SOST Protein, Cynomolgus (HEK293, His)

SOST proteins act as potent inhibitors of bone growth by effectively inhibiting Wnt signaling and subsequent bone formation. SOST exerts its inhibitory effect by interacting with key Wnt pathway components, including LRP4, LRP5, and LRP6. SOST Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived SOST protein, expressed by HEK293 , with C-His labeled tag.

SOST protein serves as a potent negative regulator of bone growth by effectively inhibiting Wnt signaling and subsequent bone formation. Through interactions with key components of the Wnt pathway, including LRP4, LRP5, and LRP6, SOST exerts its inhibitory influence. Notably, its interaction with LRP4, mediated via the extracellular domain, facilitates the suppression of Wnt signaling, while interactions with LRP5, specifically through the first two YWTD-EGF repeat domains, contribute to the inhibition of Wnt-mediated signaling. These molecular interactions underscore the crucial role of SOST in modulating the intricate signaling cascades that govern bone development, providing essential regulatory mechanisms to maintain bone homeostasis.

1.Immobilized Cynomolgus SOST, His Tag at 1 μg/ml (100 μl/Well) on the plate. Dose response curve for Anti-SOST Antibody, hFc Tag with the EC₅₀ of 20.5-34.4 ng/mL determined by ELISA.
2.Immobilized Cynomolgus SOST, His Tag at 1μg/ml (100μl/well) on the plate. Dose response curve for Human LRP-6, mFc Tag with the EC₅₀ of 10-40 ng/mL determined by ELISA.

Cynomolgus

HEK293

C-8*His

XP_005584428.2 (Q69-Y258)

102130808  [NCBI]

Partial

QGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGQCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGAAPRARKVRLVASCKCKRLTRFHNQSELKHFGPEAARPQKGRKPRPRARGAKANQAELENAY

Approximately 30-40 kDa, based on Bis-Tris PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing Bis-Tris PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.