SPARC Protein, Cynomolgus (HEK293, His)

SPARC protein is involved in the regulation of cell growth and may play a regulatory role by affecting the interaction of extracellular matrix and cytokines. SPRC protein can bind calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. It has two calcium binding sites: one is an acidic domain that can bind 5-8 Ca2+ with low affinity, and the other is an EF-hand loop that can bind Ca2+ ions with high affinity. SPARC Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived SPARC protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

SPARC protein is involved in the regulation of cell growth and may play a regulatory role by affecting the interaction of extracellular matrix and cytokines. SPRC protein can bind calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. It has two calcium binding sites: one is an acidic domain that can bind 5-8 Ca2+ with low affinity, and the other is an EF-hand loop that can bind Ca2+ ions with high affinity. SPARC Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived SPARC protein, expressed by HEK293 , with C-His labeled tag.

Background

SPARC protein is a cysteine-rich acidic secreted protein, also known as osteonectin or BM-40, and is a matricellular protein that regulates cell adhesion, extracellular matrix production, growth factor activity, and cell cycle. SPARC protein does not play a structural function, but has anti-proliferative and anti-adhesive properties that can regulate the interaction between cells and the surrounding extracellular matrix. SPRC protein is able to bind to Ca and Cu, several types of collagen, albumin, thrombospondin, PDGF, and cell membranes. It has two calcium binding sites: one is an acidic domain that can bind 5-8 Ca2+ with low affinity, and the other is an EF-hand ring that can bind Ca2+ ions with high affinity. SPARC is overexpressed in sites of injury, regeneration, obesity, cancer, and inflammation, and is a potential target and therapeutic indicator for disease treatment and evaluation.

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag C-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • SPARC (A18-I303)
      Accession # G7P8R2
    • 8*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    SPARC; Basement-Membrane Protein 40; Prev. ON; Osteonectin; BM-40; Secreted Protein, Acidic, Cysteine-Rich (Osteonectin); ONT; OI17; Secreted Protein Acidic And Rich In Cysteine; Secreted Protein Acidic And Cysteine Rich; Cysteine-Rich Protein

  • AA Sequence

    APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGPEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI

  • Predicted Molecular Mass

    33.8 kDa

  • Molecular Weight

    Approximately 43-48 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00