SPINK2 Protein, Human (HEK293, Fc)
Based on 1 Customer Validation
SPINK2, a robust acrosin inhibitor, is vital for normal spermiogenesis, preventing premature activation of proacrosin and other proteases to avoid spermiogenesis defects. It likely regulates germ cell apoptosis mediated by serine proteases and displays inhibitory activity against trypsin, indicating involvement in diverse serine protease-dependent processes. SPINK2 Protein, Human (HEK293, Fc) is the recombinant human-derived SPINK2 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
SPINK2, a robust acrosin inhibitor, is vital for normal spermiogenesis, preventing premature activation of proacrosin and other proteases to avoid spermiogenesis defects. It likely regulates germ cell apoptosis mediated by serine proteases and displays inhibitory activity against trypsin, indicating involvement in diverse serine protease-dependent processes. SPINK2 Protein, Human (HEK293, Fc) is the recombinant human-derived SPINK2 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
SPINK2, a potent inhibitor of acrosin, plays a crucial role in ensuring normal spermiogenesis. Its primary function is likely to impede the premature activation of proacrosin and other proteases, thereby preventing the initiation of events that could lead to spermiogenesis defects. SPINK2 may additionally participate in the regulation of germ cell apoptosis mediated by serine proteases. Beyond its role in acrosin inhibition, SPINK2 exhibits inhibitory activity against trypsin, suggesting its involvement in regulating various serine protease-dependent processes.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
P20155/NP_066937.1 (Q24-C84)
-
Molecular Construction
-
N-term
-
SPINK2 (Q24-C84)
Accession # P20155/NP_066937.1 -
hFc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
SPINK2; Acrosin-Trypsin Inhibitor; Serine Peptidase Inhibitor Kazal Type 2; Serine Peptidase Inhibitor, Kazal Type 2 (Acrosin-Trypsin Inhibitor); HUSI-II; Serine Protease Inhibitor, Kazal Type 2 (Acrosin-Trypsin Inhibitor); Serine Protease Inhibitor Kazal
-
AA Sequence
QFGLFSKYRTPNCSQYRLPGCPRHFNPVCGSDMSTYANECTLCMKIREGGHNIKIIRNGPC
-
Predicted Molecular Mass
33.6 kDa
-
Molecular Weight
Approximately 38 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
