Copy Link Print Information

SREC-I/SCARF1 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

SREC-I/SCARF1 Protein acts as a multifunctional mediator, facilitating Ac-LDL binding and degradation, suggesting a role in lipid metabolism and adhesion. Involved in neurite-like outgrowth, it interacts with SREC2 and AVIL, forming a complex molecular network. The protein's diverse roles underscore its significance in various cellular processes beyond lipid metabolism. SREC-I/SCARF1 Protein, Human (HEK293, His) is the recombinant human-derived SREC-I/SCARF1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for SREC-I/SCARF1 Protein, Human (HEK293, His)
  • Experimental Validation Results for SREC-I/SCARF1 Protein, Human (HEK293, His)
  • SREC-I/SCARF1 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

SREC-I/SCARF1 Protein acts as a multifunctional mediator, facilitating Ac-LDL binding and degradation, suggesting a role in lipid metabolism and adhesion. Involved in neurite-like outgrowth, it interacts with SREC2 and AVIL, forming a complex molecular network. The protein's diverse roles underscore its significance in various cellular processes beyond lipid metabolism. SREC-I/SCARF1 Protein, Human (HEK293, His) is the recombinant human-derived SREC-I/SCARF1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

SREC-I/SCARF1 Protein serves as a multifunctional mediator in cellular processes, primarily facilitating the binding and degradation of acetylated low-density lipoprotein (Ac-LDL). Beyond its role in lipid metabolism, the protein is implicated in heterophilic interactions, suggesting its function as an adhesion protein. Additionally, SREC-I/SCARF1 is involved in the regulation of neurite-like outgrowth, further emphasizing its diverse roles in cellular dynamics. The protein engages in heterophilic interactions with SREC2 via its extracellular domain, with this interaction being suppressed in the presence of ligands such as Ac-LDL. Notably, SREC-I/SCARF1 also interacts with AVIL, contributing to its intricate network of molecular associations and highlighting its involvement in various cellular processes.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. When Human AcLDL is immobilized at 10 µg/mL (100 µL/well) can bind Human SREC-I/SCARF1. The ED50 for this effect is 48.05 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. When Human AcLDL is immobilized at 10 µg/mL (100 µL/well) can bind Human SREC-I/SCARF1. The ED50 for this effect is 48.05 ng/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q14162 (S20-T421)

  • Gene ID
    8578
  • Molecular Construction
    • N-term
    • SREC-I (S20-T421)
      Accession # Q14162
    • 6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    SCARF1; Scavenger Receptor Expressed By Endothelial Cells 1; Scavenger Receptor Class F Member 1; SREC-I; Acetyl LDL Receptor; Scavenger Receptor Expressed By Endothelial Cells; SREC; Scavenger Receptor Class F, Member 1; KIAA0149; Alternative Protein SCA

  • AA Sequence

    SELDPKGQHVCVASSPSAELQCCAGWRQKDQECTIPICEGPDACQKDEVCVKPGLCRCKPGFFGAHCSSRCPGQYWGPDCRESCPCHPHGQCEPATGACQCQADRWGARCEFPCACGPHGRCDPATGVCHCEPGWWSSTCRRPCQCNTAAARCEQATGACVCKPGWWGRRCSFRCNCHGSPCEQDSGRCACRPGWWGPECQQQCECVRGRCSAASGECTCPPGFRGARCELPCPAGSHGVQCAHSCGRCKHNEPCSPDTGSCESCEPGWNGTQCQQPCLPGTFGESCEQQCPHCRHGEACEPDTGHCQRCDPGWLGPRCEDPCPTGTFGEDCGSTCPTCVQGSCDTVTGDCVCSAGYWGPSCNASCPAGFHGNNCSVPCECPEGLCHPVSGSCQPGSGSRDT

  • Predicted Molecular Mass

    42.5 kDa

  • Molecular Weight

    Approximately 58-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<0.1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. When Human AcLDL is immobilized at 10 µg/mL (100 µL/well) can bind Human SREC-I/SCARF1. The ED50 for this effect is 48.05 ng/mL.

  • SREC-I/SCARF1 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for SREC-I/SCARF1 Protein, Human (HEK293, His)
  • Experimental Validation Results for SREC-I/SCARF1 Protein, Human (HEK293, His)
  • SREC-I/SCARF1 Protein, Human (HEK293, His) Product Image