Copy Link Print Information

ST6GALNAC2 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

The ST6GALNAC2 protein is an essential enzyme that catalyzes the transfer of N-acetylneuramidyl groups to glycan chains in glycoproteins. This glycosyltransferase shows a preference for N-acetylgalactosamine (GalNAc) residues that have been modified by the addition of galactose or galactose followed by the addition of sialic acid in an α-2,3 linkage. ST6GALNAC2 Protein, Human (HEK293, His) is the recombinant human-derived ST6GALNAC2 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • ST6GALNAC2 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The ST6GALNAC2 protein is an essential enzyme that catalyzes the transfer of N-acetylneuramidyl groups to glycan chains in glycoproteins. This glycosyltransferase shows a preference for N-acetylgalactosamine (GalNAc) residues that have been modified by the addition of galactose or galactose followed by the addition of sialic acid in an α-2,3 linkage. ST6GALNAC2 Protein, Human (HEK293, His) is the recombinant human-derived ST6GALNAC2 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

ST6 N-Acetylgalactosaminide Alpha-2,6-Sialyltransferase 2 (ST6GALNAC2) is an enzyme that catalyzes the transfer of N-acetylneuraminyl groups onto glycan chains in glycoproteins. This sialyltransferase exhibits a preference for glycan structures where N-acetylgalactosamine (GalNAc) residues are already modified by the addition of galactose or galactose followed by sialic acid in alpha-2,3 linkage. The enzymatic activity of ST6GALNAC2 contributes to the addition of sialic acid residues to glycoproteins, modulating their functional properties and interactions. Sialylation is a crucial post-translational modification with implications in cell adhesion, immune response, and signaling. Understanding the substrate specificity of ST6GALNAC2 provides insights into its role in the intricate regulation of glycan structures and their impact on diverse cellular processes.

Verified Bioactivity

Measured by its ability to transfer Neu5Ac from 250 µM CMP-Neu5Ac to 0.5 mg fetuin of fetal calf serum. which can be measured by absorbance at 620 nm that incubate at 37°C .The specific activity is 825.741 pmol/min/μg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q9UJ37 (S29-R374)

  • Gene ID
    10610  [NCBI]
  • Molecular Construction
    • N-term
    • ST6GALNAC2 (S29-R374)
      Accession # Q9UJ37
    • 6*His
    • C-term
  • Protein Length

    Lumenal Domain

  • Synonyms

    ST6GALNAC2; ST6GalNAc II; Prev. SIAT7B; SIAT7-B; Prev. SIATL1; Sialyltransferase 7 ((Alpha-N-Acetylneuraminyl-2,3-Beta-Galactosyl-1,3)-N-Acetyl Galactosaminide Alpha-2,6-Sialyltransferase) B; Prev. SIAT7; Sialyltransferase 7 ((Alpha-N-Acetylneuraminyl-2,3

  • AA Sequence

    SAVQRYPGPAAGARDTTSFEAFFQSKASNSWTGKGQACRHLLHLAIQRHPHFRGLFNLSIPVLLWGDLFTPALWDRLSQHKAPYGWRGLSHQVIASTLSLLNGSESAKLFAPPRDTPPKCIRCAVVGNGGILNGSRQGPNIDAHDYVFRLNGAVIKGFERDVGTKTSFYGFTVNTMKNSLVSYWNLGFTSVPQGQDLQYIFIPSDIRDYVMLRSAILGVPVPEGLDKGDRPHAYFGPEASASKFKLLHPDFISYLTERFLKSKLINTHFGDLYMPSTGALMLLTALHTCDQVSAYGFITSNYWKFSDHYFERKMKPLIFYANHDLSLEAALWRDLHKAGILQLYQR

  • Predicted Molecular Mass

    38.8 kDa

  • Molecular Weight

    Approximately 44 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, 5 mM EDTA, 5% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • ST6GALNAC2 Protein, Human (HEK293, His) Product Image
    1/16
  • ST6GALNAC2 Protein, Human (HEK293, His) Product Image