Streptavidin Protein (A24C, His)
Streptavidin forms a strong, non-covalent, specific homotetramer with biotin, with each subunit capable of binding one biotin molecule. Streptavidin Protein (A24C, His) is the recombinant others-derived Streptavidin protein, expressed by E. coli, with C-His labeled tag.
- Species: Others
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Streptavidin forms a strong, non-covalent, specific homotetramer with biotin, with each subunit capable of binding one biotin molecule. Streptavidin Protein (A24C, His) is the recombinant others-derived Streptavidin protein, expressed by E. coli, with C-His labeled tag.
Background
The Streptomyces Avidinii Streptavidin protein, while the precise biological function remains elusive, exhibits a distinct capability to form a robust non-covalent specific complex with biotin, involving one molecule of biotin per subunit of streptavidin. This interaction highlights the protein's exceptional affinity for biotin, suggesting potential applications in various molecular and cellular processes where specific binding to biotinylated molecules is required. Structurally, streptavidin forms a homotetramer, further emphasizing its quaternary arrangement and potential functional relevance within this oligomeric configuration.
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag C-His
-
Accession
P22629-1 (C24-Q183, A24C)
-
Gene ID/
-
Molecular Construction
-
N-term
-
SA (C24-Q183, A24C)
Accession # P22629-1 -
His
-
C-term
-
-
Protein Length
Full Length of Streptavidin Chain
-
Synonyms
Streptavidin; LSA
-
AA Sequence
CDPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
-
Predicted Molecular Mass
18.6 kDa
-
Molecular Weight
Approximately 20-22 kDa, based on SDS-PAGE under reducing conditions.
-
Structure/Form
Monomer
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
