SUGP1 Protein, Human (His, Strep)
SUGP1 Protein, Human (His, Strep) is the recombinant human-derived SUGP1, expressed by E. coli , with Strep, His labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
SUGP1 Protein, Human (His, Strep) is the recombinant human-derived SUGP1, expressed by E. coli , with Strep, His labeled tag. ,
Background
SUGP1 is a protein involved in the process of pre-mRNA splicing.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Strep;His
-
Accession
Q8IWZ8-1 (E169-K243)
-
Gene ID57794
-
Protein Length
Partial
-
Synonyms
SUGP1; F23858; Prev. SF4; RNA-Binding Protein RBP; Splicing Factor 4; DKFZp434E2216; SURP And G-Patch Domain-Containing Protein 1; CDNA FLJ57089, Highly Similar To Splicing Factor 4; SURP And G-Patch Domain Containing 1; RBP
-
AA Sequence
EEDYEQWLEIKVSPPEGAETRKVIEKLARFVAEGGPELEKVAMEDYKDNPAFAFLHDKNSREFLYYRKKVAEIRK
-
Predicted Molecular Mass
12.1 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)