SULT1E1 Protein, Human (N-His)

Customer Review

Based on 1 Customer Validation

The SULT1E1 protein is a sulfotransferase that critically regulates estrogen homeostasis by sulfating estradiol and estrone, resulting in hormone inactivation. Its versatility extends to sulfated DHEA, pregnenolone, and xenobiotics such as ethinyl estradiol. SULT1E1 Protein, Human (N-His) is the recombinant human-derived SULT1E1 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The SULT1E1 protein is a sulfotransferase that critically regulates estrogen homeostasis by sulfating estradiol and estrone, resulting in hormone inactivation. Its versatility extends to sulfated DHEA, pregnenolone, and xenobiotics such as ethinyl estradiol. SULT1E1 Protein, Human (N-His) is the recombinant human-derived SULT1E1 protein, expressed by E. coli , with N-His labeled tag.

Background

SULT1E1 protein, a sulfotransferase utilizing 3'-phospho-5'-adenylyl sulfate (PAPS) as a sulfonate donor, plays a pivotal role in estrogen homeostasis by catalyzing the sulfate conjugation of estradiol and estrone, contributing to the inactivation of these hormones. Beyond its primary function in estrogen metabolism, SULT1E1 demonstrates versatility by sulfating dehydroepiandrosterone (DHEA), pregnenolone, (24S)-hydroxycholesterol, and various xenobiotic compounds such as ethinylestradiol, equalenin, diethyl stilbesterol, and 1-naphthol, albeit with lower efficiency. Notably, SULT1E1 does not sulfonate cortisol, testosterone, and dopamine. Moreover, this sulfotransferase may be implicated in gut microbiota-host metabolic interactions, as it O-sulfonates 4-ethylphenol (4-EP), a tyrosine-derived metabolite produced by gut bacteria. The resulting product, 4-EPS, crosses the blood-brain barrier and potentially exerts regulatory effects on oligodendrocyte maturation and myelination, influencing the functional connectivity of brain regions associated with the limbic system. The diverse substrate specificity of SULT1E1 highlights its crucial role in hormonal regulation and suggests its involvement in broader physiological processes, including gut-brain interactions with potential implications for neurological functions.

Verified Bioactivity

Measured by its ability to transfer sulfate from PAPS to 1-Napthol. The specific activity is 74.44 pmol/min/μg that incubate at 37 ºC for 20 minutes.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • SULT1E1 (N2-I294)
      Accession # P49888
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    SULT1E1; Estrogen Sulfotransferase; Prev. STE; EST-1; Sulfotransferase, Estrogen-Preferring; ST1E1; EST; Estrone Sulfotransferase; Sulfotransferase Family 1E, Estrogen-Preferring, Member 1; Sulfotransferase; Sulfotransferase Family 1E Member 1; Sulfotrans

  • AA Sequence

    NSELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKLSPFMRKGITGDWKNHFTVALNEKFDKHYEQQMKESTLKFRTEI

  • Predicted Molecular Mass

    35 kDa

  • Molecular Weight

    Approximately 36 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 200 mM NaCl, pH 7.4, 8% trehalose.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00