1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins STE
  4. TAOK2 Protein, Human (Active, sf9, GST)

TAOK2 is a multifunctional serine/threonine protein kinase that affects membrane blebbing, apoptotic body formation, DNA damage response, and the MAPK14/p38 MAPK cascade. It exhibits broad substrate specificity and can phosphorylate itself, MBP, activated MAPK8, MAP2K3, MAP2K6 and tubulin. TAOK2 Protein, Human (sf9, GST) is the recombinant human-derived TAOK2 protein, expressed by sf9 insect cells , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TAOK2 is a multifunctional serine/threonine protein kinase that affects membrane blebbing, apoptotic body formation, DNA damage response, and the MAPK14/p38 MAPK cascade. It exhibits broad substrate specificity and can phosphorylate itself, MBP, activated MAPK8, MAP2K3, MAP2K6 and tubulin. TAOK2 Protein, Human (sf9, GST) is the recombinant human-derived TAOK2 protein, expressed by sf9 insect cells , with N-GST labeled tag.

Background

TAOK2, a serine/threonine-protein kinase, engages in diverse cellular processes, including membrane blebbing, apoptotic bodies formation, DNA damage response, and the MAPK14/p38 MAPK stress-activated MAPK cascade. It exhibits a broad substrate specificity, phosphorylating itself, MBP, activated MAPK8, MAP2K3, MAP2K6, and tubulins. TAOK2 activates the MAPK14/p38 MAPK signaling pathway by specifically activating and phosphorylating the upstream MAP2K3 and MAP2K6 kinases. In the context of the DNA damage response, TAOK2 contributes to the G2/M transition DNA damage checkpoint by orchestrating the activation of the p38/MAPK14 stress-activated MAPK cascade, potentially through the phosphorylation of upstream MAP2K3 and MAP2K6 kinases. While isoform 1 participates in apoptotic morphological changes, including cell contraction, membrane blebbing, and apoptotic bodies formation, isoform 2 is specifically involved in PCDH8 endocytosis, triggered by homophilic interactions between PCDH8 extracellular domains. Isoform 2 phosphorylates and activates MAPK14/p38 MAPK, leading to PCDH8 endocytosis and CDH2 cointernalization. Both isoforms contribute to MAPK14 phosphorylation. Moreover, isoform 1, but not isoform 2, modulates microtubule organization and stability, independent of its kinase activity, and prevents MAP3K7-mediated activation of CHUK, thereby inhibiting NF-kappa-B activation but not that of MAPK8/JNK. Additionally, isoform 2 is implicated in the osmotic stress-MAPK8 pathway.

Species

Human

Source

Sf9 insect cells

Tag

N-GST

Accession

Q9UL54 (M1-K314)

Gene ID

9344

Molecular Construction
N-term
GST
TAOK2 (M1-K314)
Accession # Q9UL54
C-term
Protein Length

Partial

Synonyms
TAOK2; Serine/threonine-protein kinase TAO2; Kinase from chicken homolog C; hKFC-C; Prostate-derived sterile 20-like kinase 1; PSK-1; PSK1; Prostate-derived STE20-like kinase 1; Thousand and one amino acid protein kinase 2
AA Sequence

MPAGGRAGSLKDPDVAELFFKDDPEKLFSDLREIGHGSFGAVYFARDVRNSEVVAIKKMSYSGKQSNEKWQDIIKEVRFLQKLRHPNTIQYRGCYLREHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAVTHGALQGLAYLHSHNMIHRDVKAGNILLSEPGLVKLGDFGSASIMAPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLFNMNAMSALYHIAQNESPVLQSGHWSEYFRNFVDSCLQKIPQDRPTSEVLLKHRFVLRERPPTVIMDLIQRTKDAVRELDNLQYRKMKK

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TAOK2 Protein, Human (Active, sf9, GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

TAOK2 Protein, Human (Active, sf9, GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TAOK2 Protein, Human (Active, sf9, GST)
Cat. No.:
HY-P701641
Quantity:
MCE Japan Authorized Agent: