TCblR/CD320 Protein, Human (HEK293, His)
Based on 1 Customer Validation
TCblR/CD320 is the receptor for cobalamin (TCbl) and is critical for cellular cobalamin homeostasis and B cell responses. It is expressed on follicular dendritic cells, interacts with germinal center B cells, and coordinates immune responses. TCblR/CD320 Protein, Human (HEK293, His) is the recombinant human-derived TCblR/CD320 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
TCblR/CD320 is the receptor for cobalamin (TCbl) and is critical for cellular cobalamin homeostasis and B cell responses. It is expressed on follicular dendritic cells, interacts with germinal center B cells, and coordinates immune responses. TCblR/CD320 Protein, Human (HEK293, His) is the recombinant human-derived TCblR/CD320 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
TCblR/CD320, a receptor for transcobalamin saturated with cobalamin (TCbl), is a crucial player in cobalamin uptake, emphasizing its significance in cellular cobalamin homeostasis. This plasma membrane protein is prominently expressed on follicular dendritic cells (FDC), where it facilitates interaction with germinal center B cells, contributing to the orchestration of immune responses. Beyond its role in cobalamin transport, TCblR/CD320 functions as a costimulator, promoting B cell responses to antigenic stimuli. This involvement includes the enhancement of B cell differentiation and proliferation, particularly within germinal center-B cells. The intricate interplay of TCblR/CD320 with germinal center B cells, T cells, and follicular dendritic cells is crucial for the differentiation of memory B cells and plasma cells, underscoring its multifaceted role in immune regulation. Moreover, TCblR/CD320's interaction with TCN2 further elucidates its involvement in cobalamin-related processes, contributing to our understanding of its diverse cellular functions.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q9NPF0-1 (S36-V231)
-
Molecular Construction
-
N-term
-
CD320 (S36-V231)
Accession # Q9NPF0-1 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD320; TCII-R; CD320 Molecule; TCN2R; TCblR; 8D6; 8D6A; FDC-Signaling Molecule 8D6; Transcobalamin Receptor; Transcobalamin 2 Receptor; CD320 Antigen; Soluble CD320; 8D6 Antigen; FDC-SM-8D6; SCD320
-
AA Sequence
SPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGV
-
Predicted Molecular Mass
21.1 kDa
-
Molecular Weight
Approximately 32-58 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-Citrate,150 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
