TCL1A Protein, Human (His)
Based on 1 Customer Validation
TCL1A protein plays a crucial role in cell signaling by actively enhancing the phosphorylation and activation of AKT1, AKT2, and AKT3 while promoting the nuclear translocation of AKT1. Additionally, it aids cell proliferation, stabilizes mitochondrial membrane potential, and promotes cell survival. TCL1A Protein, Human (His) is the recombinant human-derived TCL1A protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
TCL1A protein plays a crucial role in cell signaling by actively enhancing the phosphorylation and activation of AKT1, AKT2, and AKT3 while promoting the nuclear translocation of AKT1. Additionally, it aids cell proliferation, stabilizes mitochondrial membrane potential, and promotes cell survival. TCL1A Protein, Human (His) is the recombinant human-derived TCL1A protein, expressed by E. coli , with N-His labeled tag.
Background
The T-cell leukemia/lymphoma protein 1A (TCL1A) is a multifaceted regulator that plays a pivotal role in cellular processes. It functions by enhancing the phosphorylation and activation of AKT1, AKT2, and AKT3, leading to their nuclear translocation. Additionally, TCL1A promotes cell proliferation, stabilizes mitochondrial membrane potential, and supports cell survival. Existing as a homodimer, TCL1A interacts with AKT1, AKT2, and AKT3 through their pleckstrin homology (PH) domain. Notably, TCL1A forms a complex with PNPT1, but this interaction does not affect PNPT1 exonuclease activity. The diverse molecular interactions and functional implications of TCL1A underscore its significance in cellular signaling pathways and contribute to our understanding of its role in cell growth and survival (
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
P56279 (A2-D114)
-
Molecular Construction
-
N-term
-
His
-
TCL1A (A2-D114)
Accession # P56279 -
C-term
-
-
Protein Length
Full Length of T-cell leukemia/lymphoma protein 1A Chain
-
Synonyms
TCL1A; Protein P14 TCL1; TCL1 Family AKT Coactivator A; Oncogene TCL-1; TCL1; Oncogene TCL1; T-Cell Leukemia/Lymphoma Protein 1A; T-Cell Lymphoma-1; T Cell Leukemia/Lymphoma 1A
-
AA Sequence
AECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD
-
Predicted Molecular Mass
13.3 kDa
-
Molecular Weight
Approximately 22 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
