TDGF1 Protein, Human (GST)

The TDGF1 protein is a GPI-anchored cell membrane protein involved in Nodal signaling. TDGF1 Protein, Human (GST) is the recombinant human-derived TDGF1 protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The TDGF1 protein is a GPI-anchored cell membrane protein involved in Nodal signaling. TDGF1 Protein, Human (GST) is the recombinant human-derived TDGF1 protein, expressed by E. coli , with N-GST labeled tag.

Background

The TDGF1 Protein, a GPI-anchored cell membrane protein, emerges as a key participant in Nodal signaling. Functioning as a Nodal coreceptor in cis, cell-associated CRIPTO, when shed by TMEM8A, dynamically modulates Nodal signaling by enabling soluble CRIPTO to serve as a Nodal coreceptor on neighboring cells. This shedding mechanism contributes to the intricate regulation of Nodal signaling pathways. Moreover, TDGF1 is implicated in the determination of epiblastic cells, which subsequently give rise to the mesoderm, underlining its significance in early developmental processes. Notably, TDGF1 interacts with the activin type-1 receptor ACVR1B, further underscoring its role in mediating critical cellular signaling events.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-GST
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • GST
    • TDGF1 (G32-D150)
      Accession # P13385
    • C-term
  • Protein Length

    Full Length of Protein Cripto Chain

  • Synonyms

    CRIPTO; Cripto-1 Growth Factor; Prev. TDGF1; Cripto-1; Teratocarcinoma-Derived Growth Factor 1; CRGF; CR-1; Growth Factor; CR; CRIPTO-1; Epidermal Growth Factor-Like Cripto Protein CR1; Cripto, EGF-CFC Family Member; Protein Cripto

  • AA Sequence

    GHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCD

  • Predicted Molecular Mass

    40.5 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00