TDGF1 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
TDGF1, a GPI-anchored protein, participates in Nodal signaling pathways as a coreceptor in cis. Shedding by Tmem8a dynamically regulates Nodal signaling, releasing soluble TDGF1. This shedding mechanism modulates the Nodal pathway and suggests a role in determining the fate of epiblastic cells, particularly in mesoderm formation. TDGF1 also interacts with ACVR1B, emphasizing its importance in cellular responses. TDGF1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TDGF1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
TDGF1, a GPI-anchored protein, participates in Nodal signaling pathways as a coreceptor in cis. Shedding by Tmem8a dynamically regulates Nodal signaling, releasing soluble TDGF1. This shedding mechanism modulates the Nodal pathway and suggests a role in determining the fate of epiblastic cells, particularly in mesoderm formation. TDGF1 also interacts with ACVR1B, emphasizing its importance in cellular responses. TDGF1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TDGF1 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
TDGF1, a glycosylphosphatidylinositol (GPI)-anchored cell membrane protein, actively participates in Nodal signaling pathways. Functioning as a Nodal coreceptor, TDGF1 operates in cis, and its cell-associated form acts synergistically with the signaling molecule. Notably, shedding of TDGF1 by Tmem8a dynamically regulates Nodal signaling by releasing soluble TDGF1, enabling it to serve as a Nodal coreceptor on neighboring cells. This shedding mechanism introduces a level of modulation to the Nodal pathway. TDGF1's involvement in these signaling cascades suggests a potential role in determining the fate of epiblastic cells, particularly those contributing to the formation of the mesoderm. Additionally, TDGF1 interacts with the activin type-1 receptor ACVR1B, further highlighting its significance in mediating crucial cellular responses.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. When Recombinant Rat Activin RIB is immobilized at 2 µg/mL(100 µL/well) can bind Recombinant Mouse TDGF1. The ED50 for this effect is 61.03 ng/mL.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
P51865 (R26-Q150)
-
Gene ID21667
-
Molecular Construction
-
N-term
-
TDGF1 (R26-Q150)
Accession # P51865 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
CRIPTO; Cripto-1 Growth Factor; Prev. TDGF1; Cripto-1; Teratocarcinoma-Derived Growth Factor 1; CRGF; CR-1; Growth Factor; CR; CRIPTO-1; Epidermal Growth Factor-Like Cripto Protein CR1; Cripto, EGF-CFC Family Member; Protein Cripto
-
AA Sequence
RDLAIRDNSIWDQKEPAVRDRSFQFVPSVGIQNSKSLNKTCCLNGGTCILGSFCACPPSFYGRNCEHDVRKEHCGSILHGTWLPKKCSLCRCWHGQLHCLPQTFLPGCDGHVMDQDLKASGTPCQ
-
Predicted Molecular Mass
13.9 kDa
-
Molecular Weight
Approximately 19-23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.2.
<0.1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
