TDGF1 Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

TDGF1, a GPI-anchored protein, participates in Nodal signaling pathways as a coreceptor in cis. Shedding by Tmem8a dynamically regulates Nodal signaling, releasing soluble TDGF1. This shedding mechanism modulates the Nodal pathway and suggests a role in determining the fate of epiblastic cells, particularly in mesoderm formation. TDGF1 also interacts with ACVR1B, emphasizing its importance in cellular responses. TDGF1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TDGF1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

TDGF1, a GPI-anchored protein, participates in Nodal signaling pathways as a coreceptor in cis. Shedding by Tmem8a dynamically regulates Nodal signaling, releasing soluble TDGF1. This shedding mechanism modulates the Nodal pathway and suggests a role in determining the fate of epiblastic cells, particularly in mesoderm formation. TDGF1 also interacts with ACVR1B, emphasizing its importance in cellular responses. TDGF1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TDGF1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

TDGF1, a glycosylphosphatidylinositol (GPI)-anchored cell membrane protein, actively participates in Nodal signaling pathways. Functioning as a Nodal coreceptor, TDGF1 operates in cis, and its cell-associated form acts synergistically with the signaling molecule. Notably, shedding of TDGF1 by Tmem8a dynamically regulates Nodal signaling by releasing soluble TDGF1, enabling it to serve as a Nodal coreceptor on neighboring cells. This shedding mechanism introduces a level of modulation to the Nodal pathway. TDGF1's involvement in these signaling cascades suggests a potential role in determining the fate of epiblastic cells, particularly those contributing to the formation of the mesoderm. Additionally, TDGF1 interacts with the activin type-1 receptor ACVR1B, further highlighting its significance in mediating crucial cellular responses.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. When Recombinant Rat Activin RIB is immobilized at 2 µg/mL(100 µL/well) can bind Recombinant Mouse TDGF1. The ED50 for this effect is 61.03 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. When Recombinant Rat Activin RIB is immobilized at 2 µg/mL (100 µL/well) can bind Recombinant Mouse TDGF1. The ED50 for this effect is 61.03 ng/mL.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • TDGF1 (R26-Q150)
      Accession # P51865
    • 6*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CRIPTO; Cripto-1 Growth Factor; Prev. TDGF1; Cripto-1; Teratocarcinoma-Derived Growth Factor 1; CRGF; CR-1; Growth Factor; CR; CRIPTO-1; Epidermal Growth Factor-Like Cripto Protein CR1; Cripto, EGF-CFC Family Member; Protein Cripto

  • AA Sequence

    RDLAIRDNSIWDQKEPAVRDRSFQFVPSVGIQNSKSLNKTCCLNGGTCILGSFCACPPSFYGRNCEHDVRKEHCGSILHGTWLPKKCSLCRCWHGQLHCLPQTFLPGCDGHVMDQDLKASGTPCQ

  • Predicted Molecular Mass

    13.9 kDa

  • Molecular Weight

    Approximately 19-23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.2.

Endotoxin Level

<0.1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00