TFF3 Protein, Canine (HEK293, His)
TFF3 Protein intricately maintains and repairs the intestinal mucosa, acting as a motogen that promotes epithelial cell mobility during healing. Existing as a monomer, TFF3 can form homodimers through disulfide linkages, suggesting a role in mediating crucial interactions. Its involvement in mucosal repair underscores TFF3's significance in dynamic processes that preserve the integrity and functionality of the intestinal lining. TFF3 Protein, Canine (HEK293, His) is the recombinant canine-derived TFF3 protein, expressed by HEK293 , with C-10*His labeled tag.
- Species: Canine
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
TFF3 Protein intricately maintains and repairs the intestinal mucosa, acting as a motogen that promotes epithelial cell mobility during healing. Existing as a monomer, TFF3 can form homodimers through disulfide linkages, suggesting a role in mediating crucial interactions. Its involvement in mucosal repair underscores TFF3's significance in dynamic processes that preserve the integrity and functionality of the intestinal lining. TFF3 Protein, Canine (HEK293, His) is the recombinant canine-derived TFF3 protein, expressed by HEK293 , with C-10*His labeled tag.
Background
The TFF3 Protein is intricately involved in the maintenance and repair of the intestinal mucosa, playing a pivotal role in promoting the mobility of epithelial cells during healing processes, acting as a motogen. The protein exists as a monomer and can form homodimers through disulfide linkages. This dimeric structure underscores its potential role in mediating interactions crucial for its functional activities. TFF3's participation in mucosal repair highlights its significance in contributing to the dynamic processes that maintain the integrity and functionality of the intestinal lining.
Technical Parameters
-
Species Canine
-
Source HEK293
-
Tag C-10*His
-
Accession
Q863B4 (Y24-F80)
-
Molecular Construction
-
N-term
-
TFF3 (Y24-F80)
Accession # Q863B4 -
10*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
TFF3; Polypeptide P1.B; Trefoil Factor 3; TFI; ITF; Intestinal Trefoil Factor; HITF; HP1.B; Trefoil Factor 3 (Intestinal); P1B
-
AA Sequence
YQGLATNLCEVPPKDRVDCGYPEITSEQCVNRGCCFDSSIHGVPWCFKPLQDTECRF
-
Predicted Molecular Mass
9.2 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
