TFPI2 Protein, Mouse (189a.a, HEK293, His)

TFPI2 (tissue factor pathway inhibitor 2) is a key regulator of matrix remodeling and has inhibitory control effects on trypsin, plasmin and factor VIIa/tissue factor. It has a weak effect on factor Xa and has no effect on thrombin. Its complex interactions extend to the formation of molecular complexes with ABCB1 and PPP2R3C, resulting in dephosphorylation of ABCB1. TFPI2 Protein, Mouse (189a.a, HEK293, His) is the recombinant mouse-derived TFPI2 protein, expressed by HEK293 , with His labeled tag.

TFPI2 (Tissue Factor Pathway Inhibitor 2) emerges as a key regulator in the intricate web of matrix remodeling orchestrated by plasmin. Its inhibitory prowess extends to trypsin, plasmin, and factor VIIa/tissue factor, with a weaker effect on factor Xa, while remaining inert to thrombin. Beyond its direct inhibitory actions, TFPI2 engages in complex interactions, forming a molecular alliance with ABCB1 and PPP2R3C. This complex formation results in the dephosphorylation of ABCB1, highlighting TFPI2's involvement in dynamic cellular processes that go beyond its primary inhibitory functions.

Measured by its ability to inhibit trypsin cleavage 20 µM fluorogenic peptide substrate, Mca-RPKPVE-Nval-WRK(Dnp)-NH2 that incubate at 37°C for 15 min. The IC₅₀ value is 1.1414 nM.

Mouse

HEK293

C-6*His

O35536 (L23-K211)

21789

Partial

LTSVSAQGNNLEICLLPLDAGPCQALIPKFYYDRDQQKCRRFNYGGCLGNANNFHSRDLCQQTCGSIEKVPPVCRSELKTYPCDKPNIRFFFNLNTMTCEPLRPGLCSRTINVFSEEATCKGLCEPRKHIPSFCSSPKDEGLCSANVTRFYFNSRNKTCETFTYTGCGGNENNFYYLDACHRACVKGWK

Approximately 25-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/vero-cell.html  [Content Brief]