Copy Link Print Information

TFPI2 Protein, Mouse (189a.a, HEK293, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

TFPI2 (tissue factor pathway inhibitor 2) is a key regulator of matrix remodeling and has inhibitory control effects on trypsin, plasmin and factor VIIa/tissue factor. It has a weak effect on factor Xa and has no effect on thrombin. Its complex interactions extend to the formation of molecular complexes with ABCB1 and PPP2R3C, resulting in dephosphorylation of ABCB1. TFPI2 Protein, Mouse (189a.a, HEK293, His) is the recombinant mouse-derived TFPI2 protein, expressed by HEK293 , with His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for TFPI2 Protein, Mouse (189a.a, HEK293, His)
  • TFPI2 Protein, Mouse (189a.a, HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

TFPI2 (tissue factor pathway inhibitor 2) is a key regulator of matrix remodeling and has inhibitory control effects on trypsin, plasmin and factor VIIa/tissue factor. It has a weak effect on factor Xa and has no effect on thrombin. Its complex interactions extend to the formation of molecular complexes with ABCB1 and PPP2R3C, resulting in dephosphorylation of ABCB1. TFPI2 Protein, Mouse (189a.a, HEK293, His) is the recombinant mouse-derived TFPI2 protein, expressed by HEK293 , with His labeled tag.

Background

TFPI2 (Tissue Factor Pathway Inhibitor 2) emerges as a key regulator in the intricate web of matrix remodeling orchestrated by plasmin. Its inhibitory prowess extends to trypsin, plasmin, and factor VIIa/tissue factor, with a weaker effect on factor Xa, while remaining inert to thrombin. Beyond its direct inhibitory actions, TFPI2 engages in complex interactions, forming a molecular alliance with ABCB1 and PPP2R3C. This complex formation results in the dephosphorylation of ABCB1, highlighting TFPI2's involvement in dynamic cellular processes that go beyond its primary inhibitory functions.

Verified Bioactivity

Measured by its ability to inhibit trypsin cleavage 20 µM fluorogenic peptide substrate, Mca-RPKPVE-Nval-WRK(Dnp)-NH2 that incubate at 37°C for 15 min. The IC50 value is 1.1414 nM.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-6*His
  • Accession

    O35536 (L23-K211)

  • Gene ID
    21789
  • Protein Length

    Partial

  • Synonyms

    TFPI2; Placental Protein 5; Tissue Factor Pathway Inhibitor 2; Retinal Pigment Epithelium Cell Factor 1; TFPI-2; Tissue Factor Pathway Inhibitor; PP5; TFPI2 Variant; REF1

  • AA Sequence

    LTSVSAQGNNLEICLLPLDAGPCQALIPKFYYDRDQQKCRRFNYGGCLGNANNFHSRDLCQQTCGSIEKVPPVCRSELKTYPCDKPNIRFFFNLNTMTCEPLRPGLCSRTINVFSEEATCKGLCEPRKHIPSFCSSPKDEGLCSANVTRFYFNSRNKTCETFTYTGCGGNENNFYYLDACHRACVKGWK

  • Predicted Molecular Mass

    21.4 kDa

  • Molecular Weight

    Approximately 25-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • TFPI2 Protein, Mouse (189a.a, HEK293, His) Product Image
    1/16
  • Experimental Validation Results for TFPI2 Protein, Mouse (189a.a, HEK293, His)
  • TFPI2 Protein, Mouse (189a.a, HEK293, His) Product Image