TGF beta 2/TGFB2 Protein, Human (HEK293, His)
In the TGF-beta-2 pathway, the TGF beta 2/TGFB2 protein serves as a precursor to latency-associated peptide (LAP) and transforming growth factor beta-2 (TGF-beta-2), regulating their formation. Crucially, TGF-β2/TGFB2 maintains TGF-β-2 in a latent state within the extracellular matrix, forming a non-covalent association with TGF-β-2. TGF beta 2/TGFB2 Protein, Human (HEK293, His) is the recombinant human-derived TGF beta 2/TGFB2 protein, expressed by HEK293, with N-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
In the TGF-beta-2 pathway, the TGF beta 2/TGFB2 protein serves as a precursor to latency-associated peptide (LAP) and transforming growth factor beta-2 (TGF-beta-2), regulating their formation. Crucially, TGF-β2/TGFB2 maintains TGF-β-2 in a latent state within the extracellular matrix, forming a non-covalent association with TGF-β-2. TGF beta 2/TGFB2 Protein, Human (HEK293, His) is the recombinant human-derived TGF beta 2/TGFB2 protein, expressed by HEK293, with N-His labeled tag.
Background
As a central player in the TGF-beta-2 signaling pathway, the TGF beta 2/TGFB2 protein assumes the role of a precursor for both the Latency-associated peptide (LAP) and the Transforming growth factor beta-2 (TGF-beta-2) chains. These chains collectively form the regulatory and active subunits of TGF-beta-2, respectively. Notably, TGF beta 2/TGFB2 is essential for maintaining the TGF-beta-2 chain in a latent state during storage within the extracellular matrix. The protein engages in non-covalent associations with TGF-beta-2, intricately regulating its activation through interactions with 'milieu molecules,' including LTBP1 and LRRC32/GARP. These interactions play a pivotal role in controlling the activation of TGF-beta-2, contributing to the finely tuned regulation of this critical signaling pathway.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-His
-
Accession
P61812-1 (A303-S414)
-
Gene ID7042
-
Molecular Construction
-
N-term
-
His
-
TGFB2 (A303-S414)
Accession # P61812-1 -
C-term
-
-
Protein Length
Full Length of TGFB2 Chain
-
Synonyms
TGFB2; Transforming Growth Factor, Beta 2; Transforming Growth Factor Beta 2; BSC-1 Cell Growth Inhibitor; Glioblastoma-Derived T-Cell Suppressor Factor; TGF-Beta2; Transforming Growth Factor Beta-2 Proprotein; Polyergin; Prepro-Transforming Growth Factor
-
AA Sequence
ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
-
Predicted Molecular Mass
47.6 kDa
-
Molecular Weight
Approximately 12 kDa & 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
