Thioredoxin/TRX Protein, Mouse (N-His)
Based on 1 Customer Validation
Thioredoxin/TRX proteins participate in multiple redox reactions, utilizing their reactive dithiol centers for reversible oxidation and disulfide bond formation.It catalyzes important dithiol-disulfide exchange and plays a key role in S-nitrosylation of cysteine residues in response to intracellular nitric oxide.Thioredoxin/TRX Protein, Mouse (N-His) is the recombinant mouse-derived Thioredoxin/TRX protein, expressed by E.coli , with N-6*His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Thioredoxin/TRX proteins participate in multiple redox reactions, utilizing their reactive dithiol centers for reversible oxidation and disulfide bond formation.It catalyzes important dithiol-disulfide exchange and plays a key role in S-nitrosylation of cysteine residues in response to intracellular nitric oxide.Thioredoxin/TRX Protein, Mouse (N-His) is the recombinant mouse-derived Thioredoxin/TRX protein, expressed by E.coli , with N-6*His labeled tag.
Background
Thioredoxin/TRX Protein is actively involved in diverse redox reactions, utilizing its active center dithiol to undergo reversible oxidation and disulfide formation, thereby catalyzing essential dithiol-disulfide exchange reactions. Beyond its classical redox functions, Thioredoxin plays a crucial role in the reversible S-nitrosylation of cysteine residues within target proteins, contributing to the cellular response to intracellular nitric oxide. Notably, it nitrosylates the active site cysteine of CASP3 in response to nitric oxide, effectively inhibiting caspase-3 activity. Moreover, Thioredoxin demonstrates regulatory influence over the FOS/JUN AP-1 DNA binding activity in ionizing radiation cells, modulating AP-1 transcriptional activity through its redox state. Additionally, Thioredoxin is implicated in the augmentation of interleukin-2 receptor TAC (IL2R/P55) expression, underscoring its multifaceted role in cellular processes beyond redox regulation.
Verified Bioactivity
Measured by its ability to catalyze the reduction of insulin. The reaction leads to precipitation, which can be measured by absorbance at 650 nm. The specific activity is 5.603 A650/min/mg, as measured under the described conditions.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His
-
Accession
P10639 (M1-A105)
-
Molecular Construction
-
N-term
-
6*His
-
TRX (M1-A105)
Accession # P10639 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
TXN; TRDX; TRX; TRX1; Thioredoxin; Trx; ATL-derived factor; ADF; Surface-associated sulphydryl protein; SASP; TXN Delta 3; Thioredoxin-2; Allergen Hom S Trx; Thioredoxin Delta 3; Thioredoxin, Mitochondrial; Testicular Tissue Protein Li 199; ADF; Surface-A
-
AA Sequence
MVKLIESKEAFQEALAAAGDKLVVVDFSATWCGPCKMIKPFFHSLCDKYSNVVFLEVDVDDCQDVAADCEVKCMPTFQFYKKGQKVGEFSGANKEKLEASITEYA
-
Predicted Molecular Mass
11.7 kDa
-
Molecular Weight
Approximately 15 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
