Copy Link Print Information

TIGIT Protein, Rabbit (HEK293, Fc)

Customer Review

Based on 1 Customer Validation

The TIGIT protein plays a key role in immune regulation and binds with high affinity to the poliovirus receptor (PVR). This interaction induces an immunosuppressive environment by increasing IL10 secretion and decreasing IL12B secretion. TIGIT Protein, Rabbit (HEK293, Fc) is the recombinant Rabbit-derived TIGIT protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Rabbit
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • TIGIT Protein, Rabbit (HEK293, Fc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The TIGIT protein plays a key role in immune regulation and binds with high affinity to the poliovirus receptor (PVR). This interaction induces an immunosuppressive environment by increasing IL10 secretion and decreasing IL12B secretion. TIGIT Protein, Rabbit (HEK293, Fc) is the recombinant Rabbit-derived TIGIT protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The TIGIT protein plays a pivotal role in immune regulation, exhibiting high-affinity binding to the poliovirus receptor (PVR). This interaction leads to increased secretion of IL10 and decreased secretion of IL12B, contributing to an immunosuppressive environment. TIGIT further exerts its immunomodulatory effect by suppressing T-cell activation and promoting the generation of mature immunoregulatory dendritic cells. Structurally, TIGIT forms a homodimer in cis, binding with high affinity to PVR, thereby creating a heterotetrameric assembly comprising two TIGIT and two PVR molecules. Additionally, TIGIT demonstrates lower-affinity binding to NECTIN2 and NECTIN3, underscoring its capacity for diverse molecular interactions. The multifaceted functions and binding affinities of TIGIT highlight its crucial role in immune regulation and its potential as a therapeutic target in modulating immune responses.

Verified Bioactivity

Immobilized Human Nectin-2 at 1 μg/well can bind Rabbit TIGIT Fc with a linear range of 58.54-94.94 ng/mL.

Technical Parameters

  • Species Rabbit
  • Source HEK293
  • Tag C-hFc
  • Accession

    G1SLC1 (A16-P142)

  • Gene ID
    100343230  [NCBI]
  • Molecular Construction
    • N-term
    • TIGIT (A16-P142)
      Accession # G1SLC1
    • hFc
    • C-term
  • Protein Length

    Partial

  • Synonyms

    TIGIT; DKFZp667A205; Prev. VSIG9; FLJ39873; Prev. VSTM3; V-Set And Immunoglobulin Domain Containing 9; V-Set And Transmembrane Domain-Containing Protein 3; Washington University Cell Adhesion Molecule; T-Cell Immunoreceptor With Ig And ITIM Domains; V-Set

  • AA Sequence

    APLLASGTMASMIVTTGNISAEEGGSAILQCHLSSTTTEVTQVNWEQQDRLLAVRHVDLGWHISPAFKERVVPGPSLSLTLLALTVNDTGEYFCTYHTYPDGIYKGRIFLEVRGSSVAEHSIGFQIP

  • Predicted Molecular Mass

    42.7 kDa

  • Molecular Weight

    Approximately 55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.2 μm filtered solution of PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • TIGIT Protein, Rabbit (HEK293, Fc) Product Image
    1/16
  • TIGIT Protein, Rabbit (HEK293, Fc) Product Image