1. Recombinant Proteins
  2. Immune Checkpoint Proteins
  3. Inhibitory Checkpoint Molecules
  4. TIGIT Protein
  5. TIGIT Protein, Rabbit (HEK293, Fc)

The TIGIT protein plays a key role in immune regulation and binds with high affinity to the poliovirus receptor (PVR). This interaction induces an immunosuppressive environment by increasing IL10 secretion and decreasing IL12B secretion. TIGIT Protein, Rabbit (HEK293, Fc) is the recombinant Rabbit-derived TIGIT protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TIGIT protein plays a key role in immune regulation and binds with high affinity to the poliovirus receptor (PVR). This interaction induces an immunosuppressive environment by increasing IL10 secretion and decreasing IL12B secretion. TIGIT Protein, Rabbit (HEK293, Fc) is the recombinant Rabbit-derived TIGIT protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The TIGIT protein plays a pivotal role in immune regulation, exhibiting high-affinity binding to the poliovirus receptor (PVR). This interaction leads to increased secretion of IL10 and decreased secretion of IL12B, contributing to an immunosuppressive environment. TIGIT further exerts its immunomodulatory effect by suppressing T-cell activation and promoting the generation of mature immunoregulatory dendritic cells. Structurally, TIGIT forms a homodimer in cis, binding with high affinity to PVR, thereby creating a heterotetrameric assembly comprising two TIGIT and two PVR molecules. Additionally, TIGIT demonstrates lower-affinity binding to NECTIN2 and NECTIN3, underscoring its capacity for diverse molecular interactions. The multifaceted functions and binding affinities of TIGIT highlight its crucial role in immune regulation and its potential as a therapeutic target in modulating immune responses.

Biological Activity

Immobilized Human Nectin-2 at 1 μg/well can bind Rabbit TIGIT Fc with a linear range of 58.54-94.94 ng/mL.

Species

Rabbit

Source

HEK293

Tag

C-hFc

Accession

G1SLC1 (A16-P142)

Gene ID
Molecular Construction
N-term
TIGIT (A16-P142)
Accession # G1SLC1
hFc
C-term
Protein Length

Partial

Synonyms
TIGIT; VSIG9; VSTM3
AA Sequence

APLLASGTMASMIVTTGNISAEEGGSAILQCHLSSTTTEVTQVNWEQQDRLLAVRHVDLGWHISPAFKERVVPGPSLSLTLLALTVNDTGEYFCTYHTYPDGIYKGRIFLEVRGSSVAEHSIGFQIP

Predicted Molecular Mass
42.7 kDa
Molecular Weight

Approximately 55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.2 μm filtered solution of PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TIGIT Protein, Rabbit (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

TIGIT Protein, Rabbit (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TIGIT Protein, Rabbit (HEK293, Fc)
Cat. No.:
HY-P78602
Quantity:
MCE Japan Authorized Agent: