TIM-3/HAVCR2 Protein, Canie (HEK293, His)

TIM-3/HAVCR2 Protein, Canie (HEK293, His) is the recombinant canine-derived TIM-3/HAVCR2 protein, expressed by HEK293, with C-His tag.

For research use only. We do not sell to patients.
  • Species: Canine
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

TIM-3/HAVCR2 Protein, Canie (HEK293, His) is the recombinant canine-derived TIM-3/HAVCR2 protein, expressed by HEK293, with C-His tag.

Background

T cell immunoglobulin mucin-3 (TIM-3) belongs to the Ig superfamily. TIM-3 is usually expressed by multiple murine and human immune cell types. TIM-3 was first discovered on IFN-γ producing Th1 and Tc1 cells. TIM-3 acts as an inhibitory receptor, and inhibits T cell functions. TIM-3 is associated with the regulation of immune responses in autoimmunity and cancer[1][5].
TIM-3 has multiple different ligands: galectin 9, phosphatidylserine (PtdSer), CEACAM1 and HMGB1, and these ligands bind to different regions on the TIM3 extracellular immunoglobulin V domain. The TIM-3-ligand axis is critical in the pathogenesis of numerous conditions, including autoimmune diseases, infections, cancers, transplant rejection, and chronic inflammation. For example, the binding of TIM-3 with galectin-9 can downregulate Th1 responses[2][3][4]. Inaddition, dysregulation of Tim-3 expression is associated with autoimmune diseases[5].

Technical Parameters

  • Species Canine
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • TIM3 (A24-R189)
      Accession # NP_001241644.1
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    HAVCR2; FLJ14428; Hepatitis A Virus Cellular Receptor 2; HAVcr-2; TIMD3; TIMD-3; TIM3; T-Cell Immunoglobulin And Mucin Domain 3; Tim-3; T Cell Immunoglobulin Mucin 3; CD366; Kidney Injury Molecule-3; T-Cell Immunoglobulin And Mucin Domain-Containing Prote

  • AA Sequence

    AYVAEVGQNADLPCTYSPTTSENLVPICWGKGSCPVFECHNTVLSTDGRNLKYQTSNRYRLMRNFHKGDVSLTIENVTLADSGTYCCRIQFPGLMNDKKSNLELVIKPAKVIATWTPWRDFTAPFPLMLTTKGHGSETQTLVALHDKQTQIPTLANELEDAGATTR

  • Predicted Molecular Mass

    20.3 kDa

  • Molecular Weight

    Approximately 38-43 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Structure/Form

    Monomer

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00