TIM-3/HAVCR2 Protein, Canie (HEK293, His)
TIM-3/HAVCR2 Protein, Canie (HEK293, His) is the recombinant canine-derived TIM-3/HAVCR2 protein, expressed by HEK293, with C-His tag.
- Species: Canine
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
TIM-3/HAVCR2 Protein, Canie (HEK293, His) is the recombinant canine-derived TIM-3/HAVCR2 protein, expressed by HEK293, with C-His tag.
Background
T cell immunoglobulin mucin-3 (TIM-3) belongs to the Ig superfamily. TIM-3 is usually expressed by multiple murine and human immune cell types. TIM-3 was first discovered on IFN-γ producing Th1 and Tc1 cells. TIM-3 acts as an inhibitory receptor, and inhibits T cell functions. TIM-3 is associated with the regulation of immune responses in autoimmunity and cancer[1][5].
TIM-3 has multiple different ligands: galectin 9, phosphatidylserine (PtdSer), CEACAM1 and HMGB1, and these ligands bind to different regions on the TIM3 extracellular immunoglobulin V domain. The TIM-3-ligand axis is critical in the pathogenesis of numerous conditions, including autoimmune diseases, infections, cancers, transplant rejection, and chronic inflammation. For example, the binding of TIM-3 with galectin-9 can downregulate Th1 responses[2][3][4]. Inaddition, dysregulation of Tim-3 expression is associated with autoimmune diseases[5].
Technical Parameters
-
Species Canine
-
Source HEK293
-
Tag C-His
-
Accession
NP_001241644.1 (A24-R189)
-
Gene ID479318
-
Molecular Construction
-
N-term
-
TIM3 (A24-R189)
Accession # NP_001241644.1 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
HAVCR2; FLJ14428; Hepatitis A Virus Cellular Receptor 2; HAVcr-2; TIMD3; TIMD-3; TIM3; T-Cell Immunoglobulin And Mucin Domain 3; Tim-3; T Cell Immunoglobulin Mucin 3; CD366; Kidney Injury Molecule-3; T-Cell Immunoglobulin And Mucin Domain-Containing Prote
-
AA Sequence
AYVAEVGQNADLPCTYSPTTSENLVPICWGKGSCPVFECHNTVLSTDGRNLKYQTSNRYRLMRNFHKGDVSLTIENVTLADSGTYCCRIQFPGLMNDKKSNLELVIKPAKVIATWTPWRDFTAPFPLMLTTKGHGSETQTLVALHDKQTQIPTLANELEDAGATTR
-
Predicted Molecular Mass
20.3 kDa
-
Molecular Weight
Approximately 38-43 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Structure/Form
Monomer
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
