TIM-1/KIM-1/HAVCR Protein, Rhesus Macaque (116a.a, HEK293, His)

TIM-1/KIM-1/HAVCR Protein, a key member and costimulatory molecule in the T cell immunoglobulin mucin (TIM) family, is expressed on the surface of T cells. It not only directly enhances the antitumor effect of CD8+ T cells and NK cells but also changes the tumor microenvironment to induce more effective antitumor immune response. In addition, agonistic anti-TIM-1 monoclonal antibody or other ligands can enhance the function of T cells, increase CD8+ T cells and NK cells, reduce MDSC in tumor tissues, and inhibit tumor growth. TIM-1/KIM-1/HAVCR Protein, Rhesus Macaque (116a.a, HEK293, His) is the recombinant Rhesus Macaque-derived TIM-1/KIM-1/HAVCR protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rhesus Macaque
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

TIM-1/KIM-1/HAVCR Protein, a key member and costimulatory molecule in the T cell immunoglobulin mucin (TIM) family, is expressed on the surface of T cells. It not only directly enhances the antitumor effect of CD8+ T cells and NK cells but also changes the tumor microenvironment to induce more effective antitumor immune response. In addition, agonistic anti-TIM-1 monoclonal antibody or other ligands can enhance the function of T cells, increase CD8+ T cells and NK cells, reduce MDSC in tumor tissues, and inhibit tumor growth. TIM-1/KIM-1/HAVCR Protein, Rhesus Macaque (116a.a, HEK293, His) is the recombinant Rhesus Macaque-derived TIM-1/KIM-1/HAVCR protein, expressed by HEK293 , with N-His labeled tag.

Background

TIM-1, a key member and costimulatory molecule in the T cell immunoglobulin mucin (TIM) family, is expressed on the surface of T cells. TIM-1 gene mutations in human and mouse are associated with some allergic diseases. Abnormal expression of TIM-1 is related to some autoimmune diseases. TIM-1 is mainly expressed on the surfaces of CD4+ T cells, CD8+ T cells, NK cells, macrophages, DCs, B cells, and mast cells. Moreover, it is also found that TIM-1 is expressed in lymphoid tissues and confirmed that TIM-1 can promote the production of cytokines and enhance the antigen induced immune response of T cells. TIM-1, a new costimulatory candidate molecule for tumor treatment, not only directly enhances the antitumor effect of CD8+ T cells and NK cells but also changes the tumor microenvironment to induce more effective antitumor immune response. Type 1 immune response of TIM-1-mediated T cell activation is associated with tumor immunity through transcription factor T-bet/Eomes and the PI3K signal pathway. As a target molecule, it may have a good application prospect in clinical cancer research. In addition, agonistic anti-TIM-1 monoclonal antibody or other ligands can enhance the function of T cells, increase CD8+ T cells and NK cells, reduce MDSC in tumor tissues, and inhibit tumor growth[1].

Technical Parameters

  • Species Rhesus Macaque
  • Source HEK293
  • Tag N-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • TIM-1 (D20-V135)
      Accession # BAJ61041.1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    HAVCR1; T-Cell Membrane Protein 1; Hepatitis A Virus Cellular Receptor 1; TIMD-1; TIM-1; KIM-1; TIMD1; TIM; TIM1; T-Cell Immunoglobulin And Mucin Domain-Containing Protein 1; KIM1; T Cell Immunoglobin Domain And Mucin Domain Protein 1; Kidney Injury Molec

  • AA Sequence

    DSVNVDGVAGLPITLPCRYNGAITSMCWNRGTCSAFSCPDGIVWTNGTHVTYRKETRYKLLGNLSRRDVSLTIANTAVSDSGIYCCRVQHSGWFNDMKITISLKIGPPRVTTTPIV

  • Predicted Molecular Mass

    15 kDa

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00