TIM-1/KIM-1/HAVCR Protein, Rhesus Macaque (116a.a, HEK293, His)
TIM-1/KIM-1/HAVCR Protein, a key member and costimulatory molecule in the T cell immunoglobulin mucin (TIM) family, is expressed on the surface of T cells. It not only directly enhances the antitumor effect of CD8+ T cells and NK cells but also changes the tumor microenvironment to induce more effective antitumor immune response. In addition, agonistic anti-TIM-1 monoclonal antibody or other ligands can enhance the function of T cells, increase CD8+ T cells and NK cells, reduce MDSC in tumor tissues, and inhibit tumor growth. TIM-1/KIM-1/HAVCR Protein, Rhesus Macaque (116a.a, HEK293, His) is the recombinant Rhesus Macaque-derived TIM-1/KIM-1/HAVCR protein, expressed by HEK293 , with N-His labeled tag.
- Species: Rhesus Macaque
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
TIM-1/KIM-1/HAVCR Protein, a key member and costimulatory molecule in the T cell immunoglobulin mucin (TIM) family, is expressed on the surface of T cells. It not only directly enhances the antitumor effect of CD8+ T cells and NK cells but also changes the tumor microenvironment to induce more effective antitumor immune response. In addition, agonistic anti-TIM-1 monoclonal antibody or other ligands can enhance the function of T cells, increase CD8+ T cells and NK cells, reduce MDSC in tumor tissues, and inhibit tumor growth. TIM-1/KIM-1/HAVCR Protein, Rhesus Macaque (116a.a, HEK293, His) is the recombinant Rhesus Macaque-derived TIM-1/KIM-1/HAVCR protein, expressed by HEK293 , with N-His labeled tag.
Background
TIM-1, a key member and costimulatory molecule in the T cell immunoglobulin mucin (TIM) family, is expressed on the surface of T cells. TIM-1 gene mutations in human and mouse are associated with some allergic diseases. Abnormal expression of TIM-1 is related to some autoimmune diseases. TIM-1 is mainly expressed on the surfaces of CD4+ T cells, CD8+ T cells, NK cells, macrophages, DCs, B cells, and mast cells. Moreover, it is also found that TIM-1 is expressed in lymphoid tissues and confirmed that TIM-1 can promote the production of cytokines and enhance the antigen induced immune response of T cells. TIM-1, a new costimulatory candidate molecule for tumor treatment, not only directly enhances the antitumor effect of CD8+ T cells and NK cells but also changes the tumor microenvironment to induce more effective antitumor immune response. Type 1 immune response of TIM-1-mediated T cell activation is associated with tumor immunity through transcription factor T-bet/Eomes and the PI3K signal pathway. As a target molecule, it may have a good application prospect in clinical cancer research. In addition, agonistic anti-TIM-1 monoclonal antibody or other ligands can enhance the function of T cells, increase CD8+ T cells and NK cells, reduce MDSC in tumor tissues, and inhibit tumor growth[1].
Technical Parameters
-
Species Rhesus Macaque
-
Source HEK293
-
Tag N-His
-
Accession
BAJ61041.1 (D20-V135)
-
Molecular Construction
-
N-term
-
His
-
TIM-1 (D20-V135)
Accession # BAJ61041.1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
HAVCR1; T-Cell Membrane Protein 1; Hepatitis A Virus Cellular Receptor 1; TIMD-1; TIM-1; KIM-1; TIMD1; TIM; TIM1; T-Cell Immunoglobulin And Mucin Domain-Containing Protein 1; KIM1; T Cell Immunoglobin Domain And Mucin Domain Protein 1; Kidney Injury Molec
-
AA Sequence
DSVNVDGVAGLPITLPCRYNGAITSMCWNRGTCSAFSCPDGIVWTNGTHVTYRKETRYKLLGNLSRRDVSLTIANTAVSDSGIYCCRVQHSGWFNDMKITISLKIGPPRVTTTPIV
-
Predicted Molecular Mass
15 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)