TIM-1/KIM-1/HAVCR Protein, Rhesus Macaque (116a.a, HEK293, His)

TIM-1/KIM-1/HAVCR Protein, a key member and costimulatory molecule in the T cell immunoglobulin mucin (TIM) family, is expressed on the surface of T cells. It not only directly enhances the antitumor effect of CD8+ T cells and NK cells but also changes the tumor microenvironment to induce more effective antitumor immune response. In addition, agonistic anti-TIM-1 monoclonal antibody or other ligands can enhance the function of T cells, increase CD8+ T cells and NK cells, reduce MDSC in tumor tissues, and inhibit tumor growth. TIM-1/KIM-1/HAVCR Protein, Rhesus Macaque (116a.a, HEK293, His) is the recombinant Rhesus Macaque-derived TIM-1/KIM-1/HAVCR protein, expressed by HEK293 , with N-His labeled tag.

TIM-1, a key member and costimulatory molecule in the T cell immunoglobulin mucin (TIM) family, is expressed on the surface of T cells. TIM-1 gene mutations in human and mouse are associated with some allergic diseases. Abnormal expression of TIM-1 is related to some autoimmune diseases. TIM-1 is mainly expressed on the surfaces of CD4+ T cells, CD8+ T cells, NK cells, macrophages, DCs, B cells, and mast cells. Moreover, it is also found that TIM-1 is expressed in lymphoid tissues and confirmed that TIM-1 can promote the production of cytokines and enhance the antigen induced immune response of T cells. TIM-1, a new costimulatory candidate molecule for tumor treatment, not only directly enhances the antitumor effect of CD8+ T cells and NK cells but also changes the tumor microenvironment to induce more effective antitumor immune response. Type 1 immune response of TIM-1-mediated T cell activation is associated with tumor immunity through transcription factor T-bet/Eomes and the PI3K signal pathway. As a target molecule, it may have a good application prospect in clinical cancer research. In addition, agonistic anti-TIM-1 monoclonal antibody or other ligands can enhance the function of T cells, increase CD8+ T cells and NK cells, reduce MDSC in tumor tissues, and inhibit tumor growth^[1].

Rhesus Macaque

HEK293

N-His

BAJ61041.1 (D20-V135)

715333  [NCBI]

Partial

DSVNVDGVAGLPITLPCRYNGAITSMCWNRGTCSAFSCPDGIVWTNGTHVTYRKETRYKLLGNLSRRDVSLTIANTAVSDSGIYCCRVQHSGWFNDMKITISLKIGPPRVTTTPIV

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. Du P, et al. Immune Regulation and Antitumor Effect of TIM-1. J Immunol Res. 2016;2016:8605134.  [Content Brief]