TNF RII/TNFRSF1B Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
TNFRII (TNFRSF1B) protein has a high ability to bind with tumor necrosis factor-alpha (TNF-α). TNFRII has pro-apoptotic function. TNFRII recruits TRAF2, induces gene expression and intensively crosstalks with TNF-R1. TNFRII selectively enhances the induction of apoptosis by the death receptor TNFRI. TNF RII/TNFRSF1B Protein, Mouse (HEK293, His) is expressed by HEK293 and has a transmembrane region with 6*His tag at the C-terminus.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
TNFRII (TNFRSF1B) protein has a high ability to bind with tumor necrosis factor-alpha (TNF-α). TNFRII has pro-apoptotic function. TNFRII recruits TRAF2, induces gene expression and intensively crosstalks with TNF-R1. TNFRII selectively enhances the induction of apoptosis by the death receptor TNFRI. TNF RII/TNFRSF1B Protein, Mouse (HEK293, His) is expressed by HEK293 and has a transmembrane region with 6*His tag at the C-terminus[1].
Background
TNFRII (TNFRSF1B) protein is a single-pass type I membrane protein belonging to the tumor necrosis factor (TNF) family. TNFRII is the major signaling receptor for TNF-α. TNFRII protein is highly regulated and typically found in immune system cells[1].
The amino acid sequence of mouse TNFRII protein has low homology between human and rhesus macaque TNFRII protein (less than 85%).
TNFRII induces apoptosis. TNFRII does not directly engage the apoptotic program, but relies on the induction of endogenous, membrane-bound TNF, which subsequently activates TNFRI. TNFRII stimulates the action of the endogenously produced membrane-bound TNF on TNFRI is drastically enhanced. TNFRII competes with TNFRI for the recruitment of newly synthesized TRAF2-bound anti-apoptotic factors, thereby promoting the formation of a caspase-8-activating TNFRI complex. TNFRII competes with TNFRI for binding of TRAF2 and the TRAF2-associated anti-apoptotic cIAP1 and cIAP2 proteins. cIAP1-initiated degradation of TRAF2, which in turn enhances receptor competition for the remaining TRAF2, cIAP1 and cIAP2 molecules. cIAP1 would have an anti-apoptotic function upon recruitment into the TNFRI signalling complex, but would switch to a net proapoptotic function upon recruitment into the TNFRII signalling complex[1][2][3].
Verified Bioactivity
Measured by its ability to inhibit TNFα-mediated cytotoxicity in L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D.The ED50 for this effect is typically 0.4-3 μg/mL in the presence of 0.1 ng/mL of recombinant mouse TNFα.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
P25119/NP_035740.2 (V23-G258)
-
Molecular Construction
-
N-term
-
TNF RII/TNFRSF1B (V23-G258)
Accession # P25119/NP_035740.2 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
TNFRSF1B; TNF-R2; Prev. TNFR2; Tumor Necrosis Factor Receptor Superfamily, Member 1B; TNFBR; Tumor Necrosis Factor Receptor Superfamily, Member 1b; P75; Tumor Necrosis Factor Binding Protein 2; TNF-R-II; Tumor Necrosis Factor Beta Receptor; TNF-R75; Solub
-
AA Sequence
VPAQVVLTPYKPEPGYECQISQEYYDRKAQMCCAKCPPGQYVKHFCNKTSDTVCADCEASMYTQVWNQFRTCLSCSSSCTTDQVEIRACTKQQNRVCACEAGRYCALKTHSGSCRQCMRLSKCGPGFGVASSRAPNGNVLCKACAPGTFSDTTSSTDVCRPHRICSILAIPGNASTDAVCAPESPTLSAIPRTLYVSQPEPTRSQPLDQEPGPSQTPSILTSLGSTPIIEQSTKGG
-
Predicted Molecular Mass
26.8 kDa
-
Molecular Weight
Approximately 33-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH7.4, 5% trehalose, 5% mannitol.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (264 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Wajant H, et, al. Tumor necrosis factor signaling. Cell Death Differ. 2003 Jan;10(1):45-65. [Content Brief]
[2]. Fotin-Mleczek M, et, al. Apoptotic crosstalk of TNF receptors: TNF-R2-induces depletion of TRAF2 and IAP proteins and accelerates TNF-R1-dependent activation of caspase-8. J Cell Sci. 2002 Jul 1;115(Pt 13):2757-70. [Content Brief]
[3]. Masli S, et, al. Anti-inflammatory effects of tumour necrosis factor (TNF)-alpha are mediated via TNF-R2 (p75) in tolerogenic transforming growth factor-beta-treated antigen-presenting cells. Immunology. 2009 May;127(1):62-72. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
