TNFRSF12A Protein, Mouse (HEK293, N-hFc)
TNFRSF12A Protein, a receptor for TNFSF12/TWEAK, exhibits a weak apoptosis-inducing ability in specific cells.It promotes angiogenesis and endothelial cell proliferation, and may modulate cellular adhesion to matrix proteins.In functional interactions, TNFRSF12A associates with TRAF1 and TRAF2, possibly with TRAF3, suggesting its involvement in signaling pathways contributing to diverse cellular processes.TNFRSF12A Protein, Mouse (HEK293, N-hFc) is the recombinant mouse-derived TNFRSF12A protein, expressed by HEK293 , with N-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Help & FAQs
Biological Activity
Description
TNFRSF12A Protein, a receptor for TNFSF12/TWEAK, exhibits a weak apoptosis-inducing ability in specific cells.It promotes angiogenesis and endothelial cell proliferation, and may modulate cellular adhesion to matrix proteins.In functional interactions, TNFRSF12A associates with TRAF1 and TRAF2, possibly with TRAF3, suggesting its involvement in signaling pathways contributing to diverse cellular processes.TNFRSF12A Protein, Mouse (HEK293, N-hFc) is the recombinant mouse-derived TNFRSF12A protein, expressed by HEK293 , with N-hFc labeled tag.
Background
The TNFRSF12A protein acts as a receptor for TNFSF12/TWEAK, with a weak ability to induce apoptosis in certain cell types. Additionally, it plays a role in promoting angiogenesis and stimulating the proliferation of endothelial cells. TNFRSF12A may also modulate cellular adhesion to matrix proteins. In its functional interactions, TNFRSF12A associates with TRAF1 and TRAF2, and possibly with TRAF3, indicating its involvement in signaling pathways that contribute to various cellular processes.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag N-hFc
-
Accession
Q9CR75 (E28-P80)
-
Gene ID27279
-
Molecular Construction
-
N-term
-
hFc)
-
TNFRSF12A (E28-P80)
Accession # Q9CR75 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
TNFRSF12A; Tumor Necrosis Factor Receptor Superfamily Member 12A; TNF Receptor Superfamily Member 12A; FGF-Inducible 14; TweakR; Tweak-Receptor; FN14; Tumor Necrosis Factor Receptor Superfamily, Member 12A; CD266; Type I Transmembrane Protein Fn14; Fibroblast Growth Factor-Inducible Immediate-Early Response Protein 14; CD266 Antigen
-
AA Sequence
EQAPGTSPCSSGSSWSADLDKCMDCASCPARPHSDFCLGCAAAPPAHFRLLW
-
Predicted Molecular Mass
32.6 kDa
-
Molecular Weight
Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
