TNF RI/TNFRSF1A Protein, Cynomolgus (HEK293, His)

TNFRSF1A Protein exhibits a deficiency in conserved residue(s) crucial for feature annotation propagation. TNF RI/TNFRSF1A Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived TNFRSF1A protein, expressed by HEK293 , with C-His labeled tag.

The TNFRSF1A protein is distinguished by its deficiency in conserved residue(s) essential for the propagation of feature annotation.

Immobilized Cynomolgus TNFR1, His Tag at 2μg/ml (100μl/well) on the plate. Dose response curve for Biotinylated Human TNF alpha, His Tag with the ED₅₀ of 10.4ng/ml determined by ELISA.

Cynomolgus

HEK293

C-8*His

A0A7N9CVF2 (L30-T211)

/

Partial

LVPPLRDREKRDSVCPQGKYIHPQNNSVCCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRYYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKTLECTKLCLPQTENVKGTEDSGTT

Approximately 32-42 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.