TNF RI/TNFRSF1A Protein, Cynomolgus (HEK293, His)
Based on 1 Customer Validation
TNFRSF1A Protein exhibits a deficiency in conserved residue(s) crucial for feature annotation propagation. TNF RI/TNFRSF1A Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived TNFRSF1A protein, expressed by HEK293 , with C-His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
TNFRSF1A Protein exhibits a deficiency in conserved residue(s) crucial for feature annotation propagation. TNF RI/TNFRSF1A Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived TNFRSF1A protein, expressed by HEK293 , with C-His labeled tag.
Background
The TNFRSF1A protein is distinguished by its deficiency in conserved residue(s) essential for the propagation of feature annotation.
Verified Bioactivity
Immobilized Cynomolgus TNFR1, His Tag at 2μg/ml (100μl/well) on the plate. Dose response curve for Biotinylated Human TNF alpha, His Tag with the ED50 of 10.4ng/ml determined by ELISA.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-8*His
-
Accession
A0A7N9CVF2 (L30-T211)
-
Gene ID/
-
Molecular Construction
-
N-term
-
TNFRSF1A (L30-T211)
Accession # A0A7N9CVF2 -
8*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
TNFRSF1A; Tumor Necrosis Factor Receptor 1; Prev. TNFR1; TNF-RI; TNFAR; TNFR-I; Tumor Necrosis Factor Receptor Superfamily Member 1A; Tumor Necrosis Factor Receptor Superfamily, Member 1A; TNF-R-I; Tumor Necrosis Factor Binding Protein 1; TNF-R55; Tumor N
-
AA Sequence
LVPPLRDREKRDSVCPQGKYIHPQNNSVCCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRYYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKTLECTKLCLPQTENVKGTEDSGTT
-
Predicted Molecular Mass
21.6 kDa
-
Molecular Weight
Approximately 32-42 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
