Copy Link Print Information

TNF RI/TNFRSF1A Protein, Human (His)

Customer Review

Based on 1 Customer Validation

TNFRSF1A (TNF RI) protein has a high ability to bind with tumor necrosis factor-alpha (TNF-α). TNFRSF1A is a STAT3 target gene that regulates the NF-κB pathway. TNFRSF1A activate NF-κB, mediate apoptosis, and function as a regulator of inflammation. TNF RI/TNFRSF1A Protein, Human (His) is expressed by E. coli with a 6*His tag at the N-terminus.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for TNF RI/TNFRSF1A Protein, Human (His)
  • Experimental Validation Results for TNF RI/TNFRSF1A Protein, Human (His)
  • Experimental Validation Results for TNF RI/TNFRSF1A Protein, Human (His)
  • TNF RI/TNFRSF1A Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

TNFRSF1A (TNF RI) protein has a high ability to bind with tumor necrosis factor-alpha (TNF-α). TNFRSF1A is a STAT3 target gene that regulates the NF-κB pathway. TNFRSF1A activate NF-κB, mediate apoptosis, and function as a regulator of inflammation. TNF RI/TNFRSF1A Protein, Human (His) is expressed by E. coli with a 6*His tag at the N-terminus[1].

Background

TNFRSF1A (TNF RI) protein is a single-pass type I membrane protein belonging to the tumor necrosis factor (TNF) family. TNFRSF1A is the major signaling receptor for TNF-α. TNFRSF1A protein is a multifunctional cytokine, which is synthesized by almost all cells[1][2].
The sequence of amino acids in TNFRSF1A from different species is very different (less than 85% similarity among human, rat and mouse).
TNFRSF1A contains a protein-protein interaction domain, called death domain (DD), can recruit other DD-containing proteins and couples the death receptors to caspase activation and apoptosis. Both soluble and membrane-bound forms of the cytokine can activate TNFRSF1A. TNFRSF1A induces cellular inflammatory damage and apoptosis by participating in mTOR, JNK, IKK, caspase 3, MAPK, and NF-κB pathways[1][3][4].

Verified Bioactivity

1.Measured by its ability to inhibit the TNF-alpha mediated cytotoxicity in the L-929  mouse fibroblast cells in the presence of the metabolic inhibitoractinomycin  D.The ED50 for this effect is 0.03-0.09 μg/mL in the presence of 0.25 ng/mL of recombinant human TNF-alpha.
2.Loaded Atrosab (HY-P990008) on AHC2 biosensor, can bind TNFRSF1A Protein, Human (His) with an affinity constant of 1.151E-08 M as determined in BLI assay.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession

    P19438-1 (I22-T211)

  • Gene ID
    7132  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • TNFRSF1A (I22-T211)
      Accession # P19438-1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    TNFRSF1A; Tumor Necrosis Factor Receptor 1; Prev. TNFR1; TNF-RI; TNFAR; TNFR-I; Tumor Necrosis Factor Receptor Superfamily Member 1A; Tumor Necrosis Factor Receptor Superfamily, Member 1A; TNF-R-I; Tumor Necrosis Factor Binding Protein 1; TNF-R55; Tumor N

  • AA Sequence

    IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT

  • Predicted Molecular Mass

    22.1 kDa

  • Molecular Weight

    Approximately 23 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Wajant H, et, al. Tumor necrosis factor signaling. Cell Death Differ. 2003 Jan;10(1):45-65. [Content Brief]

[2]. Fu Q, et, al. miR-29a up-regulation in AR42J cells contributes to apoptosis via targeting TNFRSF1A gene. World J Gastroenterol. 2016 May 28;22(20):4881-90. [Content Brief]

[3]. Zhou S, et, al. Bioinformatics Analysis Identifies TNFRSF1A as a Biomarker of Liver Injury in Sepsis TNFRSF1A is a Biomarker for Septic Liver Injury. Genet Res (Camb). 2022 Oct 15;2022:1493744. [Content Brief]

[4]. Egusquiaguirre SP, et, al. The STAT3 Target Gene TNFRSF1A Modulates the NF-κB Pathway in Breast Cancer Cells. Neoplasia. 2018 May;20(5):489-498. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to inhibit the TNF-alpha mediated cytotoxicity inthe L-929 mouse fibroblast cells in the presence of the metabolic inhibitoractinomycin D.The ED50 for this effect is 0.07651 μg/mL in the presence of 0.25 ng/mL of recombinant humanTNF-alpha, corresponding to a specific activity is 1.307×104 units/mg.

  • 1/16

    MedChemExpress Validation
     Loaded Atrosab (HY-P990008) on AHC2 biosensor, can bind TNFRSF1A Protein, Human (His) with an affinity constant of 1.151E-08 M as determined in BLI assay.

  • TNF RI/TNFRSF1A Protein, Human (His) Product Image
    1/16
  • Experimental Validation Results for TNF RI/TNFRSF1A Protein, Human (His)
  • Experimental Validation Results for TNF RI/TNFRSF1A Protein, Human (His)
  • Experimental Validation Results for TNF RI/TNFRSF1A Protein, Human (His)
  • TNF RI/TNFRSF1A Protein, Human (His) Product Image