1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens Receptor Proteins
  3. TNF Superfamily Epithelial cell CD Proteins Endothelial cell CD Proteins Cytokine Receptors
  4. TNF Receptor Superfamily TNF-RI/CD120a
  5. TNF RI/TNFRSF1A Protein, Mouse (HEK293, His)

TNFRSF1A (TNF RI) protein has a high ability to bind with tumor necrosis factor-alpha (TNF-α). TNFRSF1A is a STAT3 target gene that regulates the NF-κB pathway. TNFRSF1A activate NF-kappaB, mediate apoptosis, and function as a regulator of inflammation. TNF RI/TNFRSF1A Protein, Mouse (HEK293, His) is expressed by HEK 293 cells and has a transmembrane region with a His tag at the C-terminus.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 견적 받기
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

TNFRSF1A (TNF RI) protein has a high ability to bind with tumor necrosis factor-alpha (TNF-α). TNFRSF1A is a STAT3 target gene that regulates the NF-κB pathway. TNFRSF1A activate NF-kappaB, mediate apoptosis, and function as a regulator of inflammation. TNF RI/TNFRSF1A Protein, Mouse (HEK293, His) is expressed by HEK 293 cells and has a transmembrane region with a His tag at the C-terminus[1].

Background

TNFRSF1A (TNF RI) protein is a single-pass type I membrane protein belonging to the tumor necrosis factor (TNF) family. TNFRSF1A is the major signaling receptor for TNF-α. TNFRSF1A protein is a multifunctional cytokine, which is synthesized by almost all cells[1][2].
The sequence of amino acids in TNFRSF1A from different species is very different (less than 85% similarity among human, rat and mouse).
TNFRSF1A contains a protein-protein interaction domain, called death domain (DD), can recruit other DD-containing proteins and couples the death receptors to caspase activation and apoptosis. Both soluble and membrane-bound forms of the cytokine can activate TNFRSF1A. TNFRSF1A induces cellular inflammatory damage and apoptosis by participating in mTOR, JNK, IKK, caspase 3, MAPK, and NF-κB pathways[1][3][4].

Biological Activity

1. Immobilized human TNFa at 10 μg/mL (100 μl/well) can bind biotinylated mouse TNFRSF1A-his. The EC50 of biotinylated mouse TNFRSF1A-his is 0.28 μg/mL.
2. Immobilized mouse TNFa at 10 μg/mL (100 μl/well) can bind biotinylated mouse TNFRSF1A-his. The EC50 of biotinylated mouse TNFRSF1A-his is 0.13 μg/mL.

Species

Mouse

Source

HEK293

Tag

C-His

Accession

P25118/NP_035739.2 (L30-A212)

Gene ID
Molecular Construction
N-term
TNFRSF1A (L30-A212)
Accession # P25118/NP_035739.2
His
C-term
Protein Length

Extracellular Domain

Synonyms
Tumor necrosis factor receptor superfamily member 1A; CD120a; TNF-R1; TNFRSF1A
AA Sequence

LVPSLGDREKRDSLCPQGKYVHSKNNSICCTKCHKGTYLVSDCPSPGRDTVCRECEKGTFTASQNYLRQCLSCKTCRKEMSQVEISPCQADKDTVCGCKENQFQRYLSETHFQCVDCSPCFNGTVTIPCKETQNTVCNCHAGFFLRESECVPCSHCKKNEECMKLCLPPPLANVTNPQDSGTA

Predicted Molecular Mass
21.8 kDa
분자량

Approximately 35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

선적

Shipping with dry ice.

각종 서류
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

TNF RI/TNFRSF1A Protein, Mouse (HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
TNF RI/TNFRSF1A Protein, Mouse (HEK293, His)
Cat. No.:
HY-P73450
수량:
MCE Japan Authorized Agent: