TNF RI/TNFRSF1A Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
TNFRSF1A (TNF RI) protein has a high ability to bind with tumor necrosis factor-alpha (TNF-α). TNFRSF1A is a STAT3 target gene that regulates the NF-κB pathway. TNFRSF1A activate NF-kappaB, mediate apoptosis, and function as a regulator of inflammation. TNF RI/TNFRSF1A Protein, Mouse (HEK293, His) is expressed by HEK 293 cells and has a transmembrane region with a His tag at the C-terminus.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
TNFRSF1A (TNF RI) protein has a high ability to bind with tumor necrosis factor-alpha (TNF-α). TNFRSF1A is a STAT3 target gene that regulates the NF-κB pathway. TNFRSF1A activate NF-kappaB, mediate apoptosis, and function as a regulator of inflammation. TNF RI/TNFRSF1A Protein, Mouse (HEK293, His) is expressed by HEK 293 cells and has a transmembrane region with a His tag at the C-terminus[1].
Background
TNFRSF1A (TNF RI) protein is a single-pass type I membrane protein belonging to the tumor necrosis factor (TNF) family. TNFRSF1A is the major signaling receptor for TNF-α. TNFRSF1A protein is a multifunctional cytokine, which is synthesized by almost all cells[1][2].
The sequence of amino acids in TNFRSF1A from different species is very different (less than 85% similarity among human, rat and mouse).
TNFRSF1A contains a protein-protein interaction domain, called death domain (DD), can recruit other DD-containing proteins and couples the death receptors to caspase activation and apoptosis. Both soluble and membrane-bound forms of the cytokine can activate TNFRSF1A. TNFRSF1A induces cellular inflammatory damage and apoptosis by participating in mTOR, JNK, IKK, caspase 3, MAPK, and NF-κB pathways[1][3][4].
Verified Bioactivity
1. Immobilized human TNFa at 10 μg/mL (100 μl/well) can bind biotinylated mouse TNFRSF1A-his. The EC50 of biotinylated mouse TNFRSF1A-his is 0.28 μg/mL.
2. Immobilized mouse TNFa at 10 μg/mL (100 μl/well) can bind biotinylated mouse TNFRSF1A-his. The EC50 of biotinylated mouse TNFRSF1A-his is 0.13 μg/mL.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
P25118/NP_035739.2 (L30-A212)
-
Molecular Construction
-
N-term
-
TNFRSF1A (L30-A212)
Accession # P25118/NP_035739.2 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
TNFRSF1A; Tumor Necrosis Factor Receptor 1; Prev. TNFR1; TNF-RI; TNFAR; TNFR-I; Tumor Necrosis Factor Receptor Superfamily Member 1A; Tumor Necrosis Factor Receptor Superfamily, Member 1A; TNF-R-I; Tumor Necrosis Factor Binding Protein 1; TNF-R55; Tumor N
-
AA Sequence
LVPSLGDREKRDSLCPQGKYVHSKNNSICCTKCHKGTYLVSDCPSPGRDTVCRECEKGTFTASQNYLRQCLSCKTCRKEMSQVEISPCQADKDTVCGCKENQFQRYLSETHFQCVDCSPCFNGTVTIPCKETQNTVCNCHAGFFLRESECVPCSHCKKNEECMKLCLPPPLANVTNPQDSGTA
-
Predicted Molecular Mass
21.8 kDa
-
Molecular Weight
Approximately 35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (264 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Wajant H, et, al. Tumor necrosis factor signaling. Cell Death Differ. 2003 Jan;10(1):45-65. [Content Brief]
[2]. Fu Q, et, al. miR-29a up-regulation in AR42J cells contributes to apoptosis via targeting TNFRSF1A gene. World J Gastroenterol. 2016 May 28;22(20):4881-90. [Content Brief]
[3]. Zhou S, et, al. Bioinformatics Analysis Identifies TNFRSF1A as a Biomarker of Liver Injury in Sepsis TNFRSF1A is a Biomarker for Septic Liver Injury. Genet Res (Camb). 2022 Oct 15;2022:1493744. [Content Brief]
[4]. Egusquiaguirre SP, et, al. The STAT3 Target Gene TNFRSF1A Modulates the NF-κB Pathway in Breast Cancer Cells. Neoplasia. 2018 May;20(5):489-498. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
