Transmembrane protease serine 4 Protein, Mouse (His-SUMO)
The transmembrane protease serine 4 (TMPRSS4) protein is a plasma membrane-anchored serine protease that is critical for activating molecular pathways. Its proteolytic activity directly processes pro-uPA/PLAU into its active form. Transmembrane protease serine 4 Protein, Mouse (His-SUMO) is the recombinant mouse-derived Transmembrane protease serine 4 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The transmembrane protease serine 4 (TMPRSS4) protein is a plasma membrane-anchored serine protease that is critical for activating molecular pathways. Its proteolytic activity directly processes pro-uPA/PLAU into its active form. Transmembrane protease serine 4 Protein, Mouse (His-SUMO) is the recombinant mouse-derived Transmembrane protease serine 4 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
Background
The Transmembrane Protease Serine 4 (TMPRSS4) Protein, a plasma membrane-anchored serine protease, plays a pivotal role in the activation of various molecular pathways. Through its proteolytic activity, TMPRSS4 directly induces the processing of pro-uPA/PLAU, converting it into its active form. Additionally, TMPRSS4 exhibits the capability to activate epithelial sodium channels (ENaC). This dual functionality underscores the significance of TMPRSS4 in regulating crucial cellular processes, emphasizing its potential impact on protease-mediated cascades and ion channel activation in diverse physiological contexts.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-His;N-SUMO
-
Accession
Q8VCA5 (K52-M435)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
Tmprss4 (K52-M435)
Accession # Q8VCA5 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
TMPRSS4; Channel-Activating Serine Protease 2; Transmembrane Serine Protease 4; Type II Membrane Serine Protease; TMPRSS3; Transmembrane Protease, Serine 4; MT-SP2; Transmembrane Serine Protease 3; Membrane-Type Serine Protease 2; Channel-Activating Prote
-
AA Sequence
KVILDKYYFICGSPLTFIQRGQLCDGHLDCASGEDEEHCVKDFPEKPGVAVRLSKDRSTLQVLDAATGTWASVCFDNFTEALAKTACRQMGYDSQPAFRAVEIRPDQNLPVAQVTGNSQELQVQNGSRSCLSGSLVSLRCLDCGKSLKTPRVVGGVEAPVDSWPWQVSIQYNKQHVCGGSILDPHWILTAAHCFRKYLDVSSWKVRAGSNILGNSPSLPVAKIFIAEPNPLYPKEKDIALVKLQMPLTFSGSVRPICLPFSDEVLVPATPVWVIGWGFTEENGGKMSDMLLQASVQVIDSTRCNAEDAYEGEVTAEMLCAGTPQGGKDTCQGDSGGPLMYHSDKWQVVGIVSWGHGCGGPSTPGVYTKVTAYLNWIYNVRKSEM
-
Predicted Molecular Mass
57.8 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
