TrkB Protein, Human (sf9, Flag, Avi)
The TrkB protein is a key receptor tyrosine kinase that plays a key role in central and peripheral nervous system development. It regulates neuronal survival, proliferation, migration, differentiation, synapse formation, and plasticity. TrkB, Human (sf9, Flag, Avi) is the recombinant human-derived TrkB protein, expressed by sf9 insect cells, with N-His;N-GST labeled tag.
- Species: Human
- Source: sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The TrkB protein is a key receptor tyrosine kinase that plays a key role in central and peripheral nervous system development. It regulates neuronal survival, proliferation, migration, differentiation, synapse formation, and plasticity. TrkB, Human (sf9, Flag, Avi) is the recombinant human-derived TrkB protein, expressed by sf9 insect cells, with N-His;N-GST labeled tag.
Background
TrkB protein, a receptor tyrosine kinase, plays a critical role in the development and maturation of the central and peripheral nervous systems. It regulates various processes including neuron survival, proliferation, migration, differentiation, synapse formation, and plasticity. TrkB acts as a receptor for BDNF, NTF4, and also has the ability to bind NTF3, although less efficiently. Upon ligand binding, TrkB undergoes homodimerization, autophosphorylation, and activation. This activates downstream effectors such as SHC1, FRS2, SH2B1, SH2B2, and PLCG1, which control distinct signaling cascades. The GRB2-Ras-MAPK cascade, regulated by SHC1, FRS2, SH2B1, and SH2B2, is involved in neuronal differentiation and neurite outgrowth. The Ras-PI3 kinase-AKT1 cascade, also controlled by these effectors, primarily regulates cell growth and survival. TrkB also plays a role in synaptic plasticity and is involved in learning and memory. Through PLCG1, TrkB activates NF-Kappa-B and promotes the transcription of genes associated with cell survival. Furthermore, TrkB is implicated in neutrophin-dependent calcium signaling in glial cells and facilitates communication between neurons and glia. Overall, TrkB is a crucial player in cell survival and various neural processes.
Technical Parameters
-
Species Human
-
Source sf9 insect cells
-
Tag N-Avi;N-Flag
-
Accession
Q16620-1 (L456-G822)
-
Gene ID4915
-
Molecular Construction
-
N-term
-
Flag-Avi
-
(L456-G822)
Accession # Q16620-1 -
C-term
-
-
Protein Length
Cytoplasmic Domain
-
Synonyms
NTRK2; Neurotrophic Tyrosine Kinase, Receptor, Type 2, Isoform CRA_a; Neurotrophic Receptor Tyrosine Kinase 2; Neurotrophic Tyrosine Kinase, Receptor, Type 2; TRKB; Neurotrophin Receptor Tyrosine Kinase Type 2; BDNF/NT-3 Growth Factors Receptor; BDNF-Trop
-
AA Sequence
LARHSKFGMKGPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLKRELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipped with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)