TROP-2 Protein, Rat (246a.a, HEK293, His)
Based on 1 Customer Validation
The TROP-2 protein serves as a growth factor receptor and plays a key role in mediating cellular responses related to growth regulation. This implies its importance in transducing signals that influence cell growth processes. TROP-2 Protein, Rat (246a.a, HEK293, His) is the recombinant rat-derived TROP-2 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The TROP-2 protein serves as a growth factor receptor and plays a key role in mediating cellular responses related to growth regulation. This implies its importance in transducing signals that influence cell growth processes. TROP-2 Protein, Rat (246a.a, HEK293, His) is the recombinant rat-derived TROP-2 protein, expressed by HEK293 , with C-His labeled tag.
Background
The TROP-2 protein appears to serve as a growth factor receptor, implying a pivotal role in mediating cellular responses related to growth regulation. This suggests that TROP-2 is integral to the transduction of signals that influence cellular growth processes. A more in-depth exploration of the specific signaling pathways and downstream effects orchestrated by TROP-2 in its capacity as a growth factor receptor could yield valuable insights into its functional significance, shedding light on potential implications for cellular development and homeostasis.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-His
-
Accession
Q6P9Z6 (Q25-G270)
-
Molecular Construction
-
N-term
-
TROP-2 (Q25-G270)
Accession # Q6P9Z6 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
TACSTD2; Epithelial Glycoprotein-1; Prev. M1S1; Membrane Component, Chromosome 1, Surface Marker 1; GA733-1; Gastrointestinal Tumor-Associated Antigen GA7331; TROP2; Pancreatic Carcinoma Marker Protein GA7331; Tumor-Associated Calcium Signal Transducer 2;
-
AA Sequence
QINCTCPTNKMTICNSNGPGGVCQCRAIGSQVLVDCSTLTSKCLLLKARMSARKSSRRLVNPSEHAILDNDGLYDPECDDKGRFKARQCNQTSVCWCVNSVGVRRTDKGDQSLRCDEVVRTHHILIELRHRPTDRAFNHSDLDSELRRLFKERYKLHPSFLAAVHYEEPTIQIELQQNASQKGLRDVDIADAAYYFERDIKGESLFVGRRGLDVQVRGEPLHVERTLIYYLDEKPPQFSMKRLTTG
-
Predicted Molecular Mass
28.9 kDa
-
Molecular Weight
Approximately 35-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
