1. Recombinant Proteins
  2. CAR-T Related Proteins
  3. TROP-2
  4. TROP-2 Protein, Rat (246a.a, HEK293, His)

The TROP-2 protein serves as a growth factor receptor and plays a key role in mediating cellular responses related to growth regulation. This implies its importance in transducing signals that influence cell growth processes. TROP-2 Protein, Rat (246a.a, HEK293, His) is the recombinant rat-derived TROP-2 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TROP-2 protein serves as a growth factor receptor and plays a key role in mediating cellular responses related to growth regulation. This implies its importance in transducing signals that influence cell growth processes. TROP-2 Protein, Rat (246a.a, HEK293, His) is the recombinant rat-derived TROP-2 protein, expressed by HEK293 , with C-His labeled tag.

Background

The TROP-2 protein appears to serve as a growth factor receptor, implying a pivotal role in mediating cellular responses related to growth regulation. This suggests that TROP-2 is integral to the transduction of signals that influence cellular growth processes. A more in-depth exploration of the specific signaling pathways and downstream effects orchestrated by TROP-2 in its capacity as a growth factor receptor could yield valuable insights into its functional significance, shedding light on potential implications for cellular development and homeostasis.

Species

Rat

Source

HEK293

Tag

C-His

Accession

Q6P9Z6 (Q25-G270)

Gene ID
Molecular Construction
N-term
TROP-2 (Q25-G270)
Accession # Q6P9Z6
His
C-term
Protein Length

Extracellular Domain

Synonyms
EGP1; EGP-1; TROP2; GA733-1; gp50; T16; TACSTD2; TROP-2; M1S1; TACD2
AA Sequence

QINCTCPTNKMTICNSNGPGGVCQCRAIGSQVLVDCSTLTSKCLLLKARMSARKSSRRLVNPSEHAILDNDGLYDPECDDKGRFKARQCNQTSVCWCVNSVGVRRTDKGDQSLRCDEVVRTHHILIELRHRPTDRAFNHSDLDSELRRLFKERYKLHPSFLAAVHYEEPTIQIELQQNASQKGLRDVDIADAAYYFERDIKGESLFVGRRGLDVQVRGEPLHVERTLIYYLDEKPPQFSMKRLTTG

Predicted Molecular Mass
28.9 kDa
Molecular Weight

Approximately 35-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TROP-2 Protein, Rat (246a.a, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

TROP-2 Protein, Rat (246a.a, HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TROP-2 Protein, Rat (246a.a, HEK293, His)
Cat. No.:
HY-P78364
Quantity:
MCE Japan Authorized Agent: