TSLP Protein, Human (HEK293, Fc)

TSLP Protein, a cytokine, stimulates T-cell-attracting chemokine release from monocytes and enhances CD11c(+) dendritic cell maturation. It directly activates mast cells, possibly inducing allergic inflammation. TSLP may also possess antimicrobial properties in the oral cavity and on the skin. TSLP, Human (HEK293, Fc) is the recombinant human-derived TSLP protein, expressed by HEK293, with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

TSLP Protein, a cytokine, stimulates T-cell-attracting chemokine release from monocytes and enhances CD11c(+) dendritic cell maturation. It directly activates mast cells, possibly inducing allergic inflammation. TSLP may also possess antimicrobial properties in the oral cavity and on the skin. TSLP, Human (HEK293, Fc) is the recombinant human-derived TSLP protein, expressed by HEK293, with C-His labeled tag.

Background

The TSLP protein is a cytokine that stimulates the release of T-cell-attracting chemokines from monocytes, with a particular effect on enhancing the maturation of CD11c(+) dendritic cells. Additionally, this protein can directly activate mast cells, potentially leading to the induction of allergic inflammation. It is also suggested that TSLP may have antimicrobial properties in the oral cavity and on the skin.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • TSLP (Y29-Q159)
      Accession # Q969D9-1
    • hFc
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    Thymic Stroma-Derived Lymphopoietin; Thymic Stromal Lymphopoietin; TSLP

  • AA Sequence

    YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

  • Predicted Molecular Mass

    41.7 kDa

  • Molecular Weight

    Approximately 38-42 kDa, based on Bis-Tris PAGE under reducing conditions,due to the glycosylation.

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00