1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TSLP Protein, Human (HEK293, His-Avi)

TSLP Protein, a cytokine, stimulates T-cell-attracting chemokine release from monocytes and enhances CD11c(+) dendritic cell maturation. It directly activates mast cells, possibly inducing allergic inflammation. TSLP may also possess antimicrobial properties in the oral cavity and on the skin. TSLP Protein, Human (HEK293, His-Avi) is the recombinant human-derived TSLP protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
Muestra gratis   Apply now
Muestra gratis   Apply now
2 μg En stock
10 μg En stock
20 μg En stock
50 μg En stock
100 μg En stock
> 100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

TSLP Protein, a cytokine, stimulates T-cell-attracting chemokine release from monocytes and enhances CD11c(+) dendritic cell maturation. It directly activates mast cells, possibly inducing allergic inflammation. TSLP may also possess antimicrobial properties in the oral cavity and on the skin. TSLP Protein, Human (HEK293, His-Avi) is the recombinant human-derived TSLP protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

The TSLP protein is a cytokine that stimulates the release of T-cell-attracting chemokines from monocytes, with a particular effect on enhancing the maturation of CD11c(+) dendritic cells. Additionally, this protein can directly activate mast cells, potentially leading to the induction of allergic inflammation. It is also suggested that TSLP may have antimicrobial properties in the oral cavity and on the skin.

Actividad biológica

1. Immobilized Human TSLP, His Tag at 2 μg/mL (100 μL/well) on the plate. Dose response curve for Human TSLPR, hFc Tag with the EC50 of 0.1 μg/mL determined by ELISA.
2. Immobilized Human TSLP, His Tag at 0.5 μg/ml (100 μL/well) on the plate. Dose response curve for Anti-TSLP Antibody, hFc Tag with the EC50 of 66.0ng/ml determined by ELISA.
3.Immobilized Human TSLP, His Tag at 5 μg/mL (100 μL/well) on the plate. Dose response curve for Human TSLPR, hFc Tag with the EC50 of ≤81.5ng/ml determined by ELISA.

  • Measured by its binding ability in a functional ELISA. Immobilized Human TSLP at 5 μg/mL (100 μL/well) on the plate can bind Human TSLPR. The ED50 for this effect is 18.87 ng/mL.
Species

Human

Source

HEK293

Tag

C-Avi;C-6*His

Accession

Q969D9-1 (Y29-Q159)

Gene ID
Molecular Construction
N-term
TSLP (Y29-Q159)
Accession # Q969D9-1
6*His-Avi
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
thymic stromal lymphopoietin; TSLP
AA Sequence

YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

Predicted Molecular Mass
16.7 kDa
Peso molecular

Approximately 12 kDa & 16-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Pureza
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Documentación

TSLP Protein, Human (HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

TSLP Protein, Human (HEK293, His-Avi)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
TSLP Protein, Human (HEK293, His-Avi)
Cat. No.:
HY-P78532
Cantidad:
MCE Japan Authorized Agent: