TSPAN4 Protein, Mouse (Cell-Free, His)
- Species: Mouse
- Source: E. coli Cell-free
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Technical Parameters
-
Species Mouse
-
Source E. coli Cell-free
-
Tag N-10*His
-
Accession
Q9DCK3 (M1-A238)
-
Gene ID64540
-
Molecular Construction
-
N-term
-
10*His
-
Tspan4 (M1-A238)
Accession # Q9DCK3 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
Tspan4; Tm4sf7; Tetraspanin-4; Tspan-4; Transmembrane 4 superfamily member 7; TETRASPAN; Tetraspanin; Tetraspan TM4SF; NAG-2; NAG2; TM4SF7; Novel Antigen 2
-
AA Sequence
MARGCLQGVKYLMFAFNLLFWLGGCGVLGVGIWLAATQGNFATLSSSFPSLSAANLLIVTGTFVMAIGFVGCIGALKENKCLLLTFFVLLLLVFLLEATIAVLFFAYSDKIDSYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDWFEVYNATRVPDSCCLEFSDSCGLHEPGTWWKSPCYETVKAWLQENLLAVGIFGLCTALVQILGLTFAMTMYCQVVKADTYCA
-
Predicted Molecular Mass
32.1 kDa
-
Purity
≥ 85%, as determined by reducing SDS-PAGE .
Product Properties
Lyophilized powder
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O . For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)