TWEAK/TNFSF12 Protein, Mouse (204a.a, HEK293, rFc)

Customer Review

Based on 1 Customer Validation

TWEAK Protein refers to the cytokine tumor necrosis factor-like weak inducer of apoptosis, belongs to tumor necrosis factor (TNF) superfamily. TWEAK protein binds to FN14 and TNRFSF12/APO3, is a weak inducer of apoptosis. TWEAK does have pro-apoptotic activity for tumor cell, mediates NF-kappa-B activation, promotes angiogenesis and the proliferation of endothelial cells (ECs). TWEAK also increases IL-6 and IL-8 secretion, and could potentiate the pro-inflammatory activities of TNF and IL-1. Mouse TWEAK protein is a type II transmembrane protein with a transmembrane domain. TWEAK/TNFSF12 Protein, Mouse (HEK293, rFc) is the extracellular part of TWEAK protein, produced by HEK293 cells with N-terminal rFc-tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

TWEAK Protein refers to the cytokine tumor necrosis factor-like weak inducer of apoptosis, belongs to tumor necrosis factor (TNF) superfamily. TWEAK protein binds to FN14 and TNRFSF12/APO3, is a weak inducer of apoptosis[1]. TWEAK does have pro-apoptotic activity for tumor cell, mediates NF-kappa-B activation, promotes angiogenesis and the proliferation of endothelial cells (ECs)[2]. TWEAK also increases IL-6 and IL-8 secretion, and could potentiate the pro-inflammatory activities of TNF and IL-1[3]. Mouse TWEAK protein is a type II transmembrane protein with a transmembrane domain. TWEAK/TNFSF12 Protein, Mouse (HEK293, rFc) is the extracellular part of TWEAK protein, produced by HEK293 cells with N-terminal rFc-tag.

Background

TWEAK Protein refers to the cytokine tumor necrosis factor-like weak inducer of apoptosis. It is a multifunctional cytokine belonging to tumor necrosis factor (TNF) superfamily, acts function by binding TweakR/Fn14 receptor. TWEAK is a cell surface-associated type II transmembrane protein with 2 types protein chain: the membrane form and the secreted or soluble form. The soluble form derives from the membrane form by proteolytic processing. The protein sequences in human and mouse is very different with similarity of 24.79%[1].
TWEAK binds to FN14 and possibly also to TNRFSF12/APO3, is a weak inducer of apoptosis in some cell types. TWEAK mediates NF-kappa-B activation, promotes angiogenesis and the proliferation of endothelial cells[2].
TWEAK has multiple biological activities, many of which are associated with immune system development and function[1].
TWEAK does have pro-apoptotic activity on a select group of human tumor cell lines and on monocytes, while it promotes cell proliferation in human vascular EC and SMC. Furthermore, FGF-2 co-treatment can potentiate TWEAK-stimulated HUVEC proliferation, an effect that may be due to the ability of FGF-2 to up-regulate TweakR/Fn14 gene expression. At the meanwhile TWEAK-TweakR/Fn14 autocrine signaling promotes human microvascular renal EC (HMREC) migration[1].
TWEAK also plays key role in inflammatory response. TWEAK, stimulates interleukin (IL)-8 secretion in human tumor cell lines, WI-38 fibroblasts and astrocytes. TWEAK also increases IL-6 secretion and ICAM-1 expression in astrocyte cell. Moreover, TWEAK co-incubation could potentiate the pro-inflammatory activities of TNF and IL-1, and concluded that TWEAK could be involved in the pathogenesis of chronic inflammatory diseases[3].
Above all, TWEAK involves in stimulation of cell growth and angiogenesis, induction of inflammatory cytokines, and under some experimental conditions, stimulation of apoptosis[1].

Verified Bioactivity

Mouse TNFSF12, Rabbit Fc Tag immobilized on CM5 Chip can bind Mouse TNFRSF12A, hFc Tag with an affinity constant of 0.12 nM as determined in SPR assay (Biacore T200).

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag N-rFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • rFc
    • TWEAK (S46-H249)
      Accession # O54907
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    TNFSF12; TNLG4A; TNF Superfamily Member 12; TNF12; TWEAK; Tumor Necrosis Factor Superfamily Member 12; DR3LG; TNF-Related WEAK Inducer Of Apoptosis; APO3L; Tumor Necrosis Factor Ligand 4A; Tumor Necrosis Factor Ligand Superfamily Member 12; HCG1991317, Isoform CRA_a; Tumor Necrosis Factor (Ligand) Superfamily, Member 12; APO3/DR3 Ligand; TNF-Related Weak Inducer Of Apoptosis; TNFSF12 Protein; APO3 Ligand

  • AA Sequence

    SWATLSAQEPSQEELTAEDRREPPELNPQTEESQDVVPFLEQLVRPRRSAPKGRKARPRRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEETKINSSSPLRYDRQIGEFTVIRAGLYYLYCQVHFDEGKAVYLKLDLLVNGVLALRCLEEFSATAASSPGPQLRLCQVSGLLPLRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH

  • Predicted Molecular Mass

    49 kDa

  • Molecular Weight

    Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00