1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Pseudokinases TK
  4. Jak
  5. TYK2 Protein, Human (Active, sf9, GST)

TYK2 Protein, Human (Active, sf9, GST) is the recombinant human-derived TYK2 protein, expressed by Sf9 insect cells, with N-His tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TYK2 Protein, Human (Active, sf9, GST) is the recombinant human-derived TYK2 protein, expressed by Sf9 insect cells, with N-His tag.

Background

TYK2 is a non-receptor tyrosine kinase involved in signaling by various cytokines and interferons, regulating cell growth, development, migration, and innate/adaptive immunity. It plays both structural and catalytic roles in interleukin and interferon (e.g., IFN-alpha/beta) signaling. TYK2 associates with heterodimeric cytokine receptor complexes and activates STAT family members, including STAT1, STAT3, STAT4, or STAT6. These receptor complexes consist of (1) a TYK2-associated receptor chain (e.g., IFNAR1, IL12RB1, IL10RB, or IL13RA1) and (2) a second receptor chain bound to either JAK1 or JAK2. Upon cytokine binding, TYK2 phosphorylates and activates receptors, creating docking sites for STAT proteins. Recruited STATs are then phosphorylated by TYK2 (or JAK1/JAK2 on the second receptor chain), forming homo- or heterodimers that translocate to the nucleus to regulate cytokine/growth factor-responsive genes. Additionally, TYK2 negatively regulates STAT3 activity by promoting phosphorylation at a specific tyrosine site distinct from its signaling site.

Species

Human

Source

Sf9 insect cells

Tag

N-GST

Accession

P29597 (M564-C1187)

Gene ID

7297

Molecular Construction
N-term
GST
TYK2 (564-C1187)
Accession # P29597
C-term
Protein Length

Partial

Synonyms
TYK2; tyrosine kinase 2; non-receptor tyrosine-protein kinase TYK2; JTK1
AA Sequence

PHNLADVLTVNPDSPASDPTVFHKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIDILRTLYHEHIIKYKGCCEDQGEKSLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHAQHYIHRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYYASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTVLRLTELLERGERLPRPDKCPCEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYQGQAPSVFSVC

Predicted Molecular Mass
97 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TYK2 Protein, Human (Active, sf9, GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

TYK2 Protein, Human (Active, sf9, GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TYK2 Protein, Human (Active, sf9, GST)
Cat. No.:
HY-P705947
Quantity:
MCE Japan Authorized Agent: