TYK2 Protein, Human (Active, sf9, His)
TYK2 Protein, Human (Active, sf9, His) is the recombinant human-derived TYK2 protein, expressed by Sf9 insect cells, with N-His tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
TYK2 Protein, Human (Active, sf9, His) is the recombinant human-derived TYK2 protein, expressed by Sf9 insect cells, with N-His tag.
Background
TYK2 is a non-receptor tyrosine kinase involved in signaling by various cytokines and interferons, regulating cell growth, development, migration, and innate/adaptive immunity. It plays both structural and catalytic roles in interleukin and interferon (e.g., IFN-alpha/beta) signaling. TYK2 associates with heterodimeric cytokine receptor complexes and activates STAT family members, including STAT1, STAT3, STAT4, or STAT6. These receptor complexes consist of (1) a TYK2-associated receptor chain (e.g., IFNAR1, IL12RB1, IL10RB, or IL13RA1) and (2) a second receptor chain bound to either JAK1 or JAK2. Upon cytokine binding, TYK2 phosphorylates and activates receptors, creating docking sites for STAT proteins. Recruited STATs are then phosphorylated by TYK2 (or JAK1/JAK2 on the second receptor chain), forming homo- or heterodimers that translocate to the nucleus to regulate cytokine/growth factor-responsive genes. Additionally, TYK2 negatively regulates STAT3 activity by promoting phosphorylation at a specific tyrosine site distinct from its signaling site.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-10*His
-
Accession
P29597 (P871-C1187)
-
Gene ID7297
-
Molecular Construction
-
N-term
-
10*His
-
TYK2 (P871-C1187)
Accession # P29597 -
C-term
-
-
Protein Length
Partial
-
Synonyms
TYK2; Non-receptor tyrosine-protein kinase TYK2; EC 2.7.10.2; Tyrosine Kinase 2; JTK1; IMD35; Tyrosine-Protein Kinase; Non-Specific Protein-Tyrosine Kinase
-
AA Sequence
PHNLADVLTVNPDSPASDPTVFHKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIDILRTLYHEHIIKYKGCCEDQGEKSLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHAQHYIHRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYYASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTVLRLTELLERGERLPRPDKCPCEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYQGQAPSVFSVC
-
Predicted Molecular Mass
38.5 kDa
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)