TYK2 Protein, Human (Active, sf9, His)

TYK2 Protein, Human (Active, sf9, His) is the recombinant human-derived TYK2 protein, expressed by Sf9 insect cells, with N-His tag.

TYK2 is a non-receptor tyrosine kinase involved in signaling by various cytokines and interferons, regulating cell growth, development, migration, and innate/adaptive immunity. It plays both structural and catalytic roles in interleukin and interferon (e.g., IFN-alpha/beta) signaling. TYK2 associates with heterodimeric cytokine receptor complexes and activates STAT family members, including STAT1, STAT3, STAT4, or STAT6. These receptor complexes consist of (1) a TYK2-associated receptor chain (e.g., IFNAR1, IL12RB1, IL10RB, or IL13RA1) and (2) a second receptor chain bound to either JAK1 or JAK2. Upon cytokine binding, TYK2 phosphorylates and activates receptors, creating docking sites for STAT proteins. Recruited STATs are then phosphorylated by TYK2 (or JAK1/JAK2 on the second receptor chain), forming homo- or heterodimers that translocate to the nucleus to regulate cytokine/growth factor-responsive genes. Additionally, TYK2 negatively regulates STAT3 activity by promoting phosphorylation at a specific tyrosine site distinct from its signaling site.

Human

Sf9 insect cells

N-His

P29597 (P871-C1187)

7297

Partial

PHNLADVLTVNPDSPASDPTVFHKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIDILRTLYHEHIIKYKGCCEDQGEKSLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHAQHYIHRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYYASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTVLRLTELLERGERLPRPDKCPCEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYQGQAPSVFSVC

≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 50 mM Tris, 150 mM NaCl, pH7.5 with glycerol as protectant.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

Please use rapid thawing with running water to thaw the protein.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.