Type-1A pilin/fimA Protein, E.coli (His-SUMO)
Type 1A pilins, also known as fimA proteins, promote bacterial colonization by forming pili, or fimbriae (polar filaments extending from the surface of bacteria, reaching 0.5-1.5 microns in length and 100-300 per cell) . These pili play a crucial role in promoting bacterial adhesion to the epithelium of specific host organs. Type-1A pilin/fimA Protein, E.coli (His-SUMO) is the recombinant E. coli-derived Type-1A pilin/fimA protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
- Species: E.coli
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Type 1A pilins, also known as fimA proteins, promote bacterial colonization by forming pili, or fimbriae (polar filaments extending from the surface of bacteria, reaching 0.5-1.5 microns in length and 100-300 per cell) . These pili play a crucial role in promoting bacterial adhesion to the epithelium of specific host organs. Type-1A pilin/fimA Protein, E.coli (His-SUMO) is the recombinant E. coli-derived Type-1A pilin/fimA protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
Background
Type-1A pilin, encoded by the fimA gene, is a key component of bacterial fimbriae or pili, which are polar filaments extending from the surface of the bacterium to lengths of 0.5-1.5 micrometers, numbering 100-300 per cell. These fimbriae play a crucial role in facilitating bacterial colonization of the epithelium of specific host organs. The fimA protein is integral to the structure and function of these fimbriae, enabling bacterial adhesion to host tissues and promoting interactions that are essential for successful colonization.
Technical Parameters
-
Species E.coli
-
Source E. coli
-
Tag N-His;N-SUMO
-
Accession
P04128 (A24-Q182)
-
Gene ID948838 [NCBI]
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
fimA (A24-Q182)
Accession # P04128 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Type-1 fimbrial protein; Type-1A pilin; fimA; pilA; b4314; JW4277
-
AA Sequence
AATTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVRTASLAQEGATSSAVGFNIQLNDCDTNVASKAAVAFLGTAIDAGHTNVLALQSSAAGSATNVGVQILDRTGAALTLDGATFSSETTLNNGTNTIPFQARYFATGAATPGAANADATFKVQYQ
-
Predicted Molecular Mass
31.8 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
