Type-1A pilin/fimA Protein, E.coli (His-SUMO)

Type 1A pilins, also known as fimA proteins, promote bacterial colonization by forming pili, or fimbriae (polar filaments extending from the surface of bacteria, reaching 0.5-1.5 microns in length and 100-300 per cell) . These pili play a crucial role in promoting bacterial adhesion to the epithelium of specific host organs. Type-1A pilin/fimA Protein, E.coli (His-SUMO) is the recombinant E. coli-derived Type-1A pilin/fimA protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Type-1A pilin, encoded by the fimA gene, is a key component of bacterial fimbriae or pili, which are polar filaments extending from the surface of the bacterium to lengths of 0.5-1.5 micrometers, numbering 100-300 per cell. These fimbriae play a crucial role in facilitating bacterial colonization of the epithelium of specific host organs. The fimA protein is integral to the structure and function of these fimbriae, enabling bacterial adhesion to host tissues and promoting interactions that are essential for successful colonization.

E.coli

E. coli

N-His;N-SUMO

P04128 (A24-Q182)

948838  [NCBI]

Full Length of Mature Protein

AATTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVRTASLAQEGATSSAVGFNIQLNDCDTNVASKAAVAFLGTAIDAGHTNVLALQSSAAGSATNVGVQILDRTGAALTLDGATFSSETTLNNGTNTIPFQARYFATGAATPGAANADATFKVQYQ

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.