1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. UB2E2 Protein, Human (sf9, His, StrepⅡ)

The UB2E2 protein is a key ubiquitin-proteasome system participant, acting as an E2 ubiquitin-conjugating enzyme that accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to proteins. In vitro, UB2E2 exhibits multifunctionality by catalyzing polyubiquitination of “Lys-11,” “Lys-48,” and “Lys-63” linkages, suggesting its involvement in diverse cellular processes. UB2E2 Protein, Human (sf9, His, Strep) is the recombinant human-derived UB2E2 protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The UB2E2 protein is a key ubiquitin-proteasome system participant, acting as an E2 ubiquitin-conjugating enzyme that accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to proteins. In vitro, UB2E2 exhibits multifunctionality by catalyzing polyubiquitination of “Lys-11,” “Lys-48,” and “Lys-63” linkages, suggesting its involvement in diverse cellular processes. UB2E2 Protein, Human (sf9, His, Strep) is the recombinant human-derived UB2E2 protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.

Background

UB2E2, a pivotal player in the ubiquitin-proteasome system, functions as an E2 ubiquitin-conjugating enzyme, accepting ubiquitin from the E1 complex and catalyzing its covalent attachment to other proteins. In vitro, UB2E2 showcases its versatility by catalyzing 'Lys-11'-, 'Lys-48'-, and 'Lys-63'-linked polyubiquitination, indicating its involvement in diverse cellular processes. Additionally, UB2E2 displays a unique capability to catalyze the ISGylation of influenza A virus NS1 protein, further expanding its functional repertoire and highlighting its significance in antiviral responses. This multifaceted activity underscores UB2E2's crucial role in protein modification and degradation pathways within the cellular regulatory network.

Species

Human

Source

Sf9 insect cells

Tag

N-StrepⅡ;N-8*His

Accession

Q96LR5 (S2-T201)

Gene ID

7325

Molecular Construction
N-term
8*His-StrepⅡ
UB2E2 (S2-T201)
Accession # Q96LR5
C-term
Protein Length

Full Length of Mature Protein

Synonyms
UBE2E2; Ubiquitin-conjugating enzyme E2 E2; E2 ubiquitin-conjugating enzyme E2; UbcH8; Ubiquitin carrier protein E2; Ubiquitin-protein ligase E2
AA Sequence

STEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

UB2E2 Protein, Human (sf9, His, StrepⅡ) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

UB2E2 Protein, Human (sf9, His, StrepⅡ)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
UB2E2 Protein, Human (sf9, His, StrepⅡ)
Cat. No.:
HY-P701496
Quantity:
MCE Japan Authorized Agent: