UB2E2 Protein, Human (sf9, His, StrepⅡ)

The UB2E2 protein is a key ubiquitin-proteasome system participant, acting as an E2 ubiquitin-conjugating enzyme that accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to proteins. In vitro, UB2E2 exhibits multifunctionality by catalyzing polyubiquitination of “Lys-11,” “Lys-48,” and “Lys-63” linkages, suggesting its involvement in diverse cellular processes. UB2E2 Protein, Human (sf9, His, Strep) is the recombinant human-derived UB2E2 protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The UB2E2 protein is a key ubiquitin-proteasome system participant, acting as an E2 ubiquitin-conjugating enzyme that accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to proteins. In vitro, UB2E2 exhibits multifunctionality by catalyzing polyubiquitination of “Lys-11,” “Lys-48,” and “Lys-63” linkages, suggesting its involvement in diverse cellular processes. UB2E2 Protein, Human (sf9, His, Strep) is the recombinant human-derived UB2E2 protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.

Background

UB2E2, a pivotal player in the ubiquitin-proteasome system, functions as an E2 ubiquitin-conjugating enzyme, accepting ubiquitin from the E1 complex and catalyzing its covalent attachment to other proteins. In vitro, UB2E2 showcases its versatility by catalyzing 'Lys-11'-, 'Lys-48'-, and 'Lys-63'-linked polyubiquitination, indicating its involvement in diverse cellular processes. Additionally, UB2E2 displays a unique capability to catalyze the ISGylation of influenza A virus NS1 protein, further expanding its functional repertoire and highlighting its significance in antiviral responses. This multifaceted activity underscores UB2E2's crucial role in protein modification and degradation pathways within the cellular regulatory network.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag N-StrepⅡ;N-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 8*His-StrepⅡ
    • UB2E2 (S2-T201)
      Accession # Q96LR5
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    UBE2E2; Ubiquitin Conjugating Enzyme E2 E2; UbcH8; Ubiquitin-Conjugating Enzyme E2E 2 (Homologous To Yeast UBC4/5); Ubiquitin-Conjugating Enzyme E2E 2 (UBC4/5 Homolog,Yeast); Ubiquitin-Conjugating Enzyme E2 E2; E2 Ubiquitin-Conjugating Enzyme E2; Ubiquiti

  • AA Sequence

    STEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00