UB2E2 Protein, Human (sf9, His, StrepⅡ)
The UB2E2 protein is a key ubiquitin-proteasome system participant, acting as an E2 ubiquitin-conjugating enzyme that accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to proteins. In vitro, UB2E2 exhibits multifunctionality by catalyzing polyubiquitination of “Lys-11,” “Lys-48,” and “Lys-63” linkages, suggesting its involvement in diverse cellular processes. UB2E2 Protein, Human (sf9, His, Strep) is the recombinant human-derived UB2E2 protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The UB2E2 protein is a key ubiquitin-proteasome system participant, acting as an E2 ubiquitin-conjugating enzyme that accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to proteins. In vitro, UB2E2 exhibits multifunctionality by catalyzing polyubiquitination of “Lys-11,” “Lys-48,” and “Lys-63” linkages, suggesting its involvement in diverse cellular processes. UB2E2 Protein, Human (sf9, His, Strep) is the recombinant human-derived UB2E2 protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.
UB2E2, a pivotal player in the ubiquitin-proteasome system, functions as an E2 ubiquitin-conjugating enzyme, accepting ubiquitin from the E1 complex and catalyzing its covalent attachment to other proteins. In vitro, UB2E2 showcases its versatility by catalyzing 'Lys-11'-, 'Lys-48'-, and 'Lys-63'-linked polyubiquitination, indicating its involvement in diverse cellular processes. Additionally, UB2E2 displays a unique capability to catalyze the ISGylation of influenza A virus NS1 protein, further expanding its functional repertoire and highlighting its significance in antiviral responses. This multifaceted activity underscores UB2E2's crucial role in protein modification and degradation pathways within the cellular regulatory network.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-StrepⅡ;N-8*His
-
Accession
Q96LR5 (S2-T201)
-
Gene ID7325
-
Molecular Construction
-
N-term
-
8*His-StrepⅡ
-
UB2E2 (S2-T201)
Accession # Q96LR5 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
UBE2E2; Ubiquitin Conjugating Enzyme E2 E2; UbcH8; Ubiquitin‑Conjugating Enzyme E2E 2 (Homologous To Yeast UBC4/5); Ubiquitin‑Conjugating Enzyme E2E 2 (UBC4/5 Homolog,Yeast); Ubiquitin‑Conjugating Enzyme E2 E2; E2 Ubiquitin‑Conjugating Enzyme E2; Ubiquiti
-
AA Sequence
STEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
